CAZyme Information: MGYG000001559_01469

Basic Information

• Species: Anaeroglobus massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Anaeroglobus; Anaeroglobus massiliensis
• CAZyme ID: MGYG000001559_01469
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	MGYG000001559_1|CGC11	62752.25	9.3598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001559	1715864	Isolate	not provided	not provided

• Gene Location: Start: 1490558; End: 1492186 Strand: -

Full Sequence      

MKQYRFLLPLFITTFIFLTVGNSYLAVTDPVESNYALTAKEMVLSGAPLSPRIYDTVWFD
KPIFTYWVLYIAYTLFGFSDFATRLPFALCGALSVTVLAYYTRRRQNGIALSCLIAAIAA
TSLLFWAVTHSVLTDQYLLLFTEISLFSIYIGMNENSRLHTCIAYGAAACAVLTKGPVGI
ILPGLIILLYIVCEQKSVYLRRLFRPEGILLFFLLALPWYVYMYRLYGTAFIDGLLGFNT
MTRALVSEHPQENVIYYYFLLLPVALLPWTGAAFYGMRRFFRKNGFPLFLAVWAFVPLLF
YTVMATKYPTYTYISHIPFFYFAMLGVRCLREANTRKIHFILTGPAIFYWLLFWLAALFI
HVDYVRLNSLWPLFIFLPCAIVLTLFAQRMKAYIVLPVLVCFATATMYVLLTWQVLIPFY
SYRSTVPLAANAASFGMYKVYFFEEFRTSFVYYTGIPALLVTPSGYDESKRLKRDPVWTQ
KHLFKEENEQTFSELVKAREKLLLIVPKSRLDDFKNSEFYENMTLQNIYGTFSIYVPRKD
TI

Enzyme Prediction     

No EC number prediction in MGYG000001559_01469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	437	1.1e-73	0.8277777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.81e-34	5	434	8	448	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.13e-18	1	336	4	343	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.16e-08	60	178	1	118	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	6.94e-05	32	227	32	238	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL21032.1	4.37e-171	1	535	1	534
AXB83023.1	1.33e-160	1	520	1	519
CCC72525.1	1.70e-146	1	537	1	534
AVO73980.1	1.70e-146	1	537	1	534
ALG41393.1	4.82e-146	1	537	1	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	7.26e-19	30	311	57	348	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	6.73e-23	5	403	4	384	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A4WAM1	1.58e-18	1	334	1	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
A0KGY4	2.74e-18	5	336	5	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B2K5L1	2.80e-18	7	311	11	318	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
B1JJ32	2.80e-18	7	311	11	318	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.363260	0.629651	0.003474	0.001053	0.000884	0.001654

TMHMM  Annotations     

start	end
5	27
82	101
108	130
167	189
210	232
254	276
288	305
309	331
338	360
370	387
394	416
426	443