CAZyme Information: MGYG000001560_00095

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_00095
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1790	MGYG000001560_1|CGC3	195007.48	4.1741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 125028; End: 130400 Strand: +

Full Sequence      

MKKLIATLVATVMMASTVLSSGITAFAADGNTAPEAPTNTKVELLENPYGINTKDPSFSW
AMVDADKDEVQTAYRIVVGTSQENMQNQNYIKDTDWVSSSESSYIKAGLSDVLKDNSLYY
WSVQLKDKDGKESPLSEPQAFTTAVGDGWESINGIWVDPNAAAAVEDPFQKHGWTNYAVE
MDMKTSVALGVVFRAQDNSNGYMIQFRYGGGIDQGGNTMNPHTIINGGVKAYGNSIKLAD
KGIELPNNEYFRVKIAVYGEVATVYINTGDGFKEAGKVTFDGGLTYGSIGFRNGSTENGY
VDNIDVYPISDEAGTKSGDSLYSVNFDDGQTPNDFNTGNKFKVENGALYVPTGNENGTIK
TMVRLNSNSVYPGEGSDTTIAPKGNFAFLRNEFNVDNKDQIEKAVVNVTAKSPEKTRQFV
FNLYMNGQFVGLGPARFGTNLTNGKGVLYYNTYDVTNLLQNGENVIGAINYTQDEKSFLC
QMTVFYKDGSSDVLVNSADGTWKALDGTNIFGDNGKSIGTGYFNAAAENINANLFPYGWN
EPGYDDSAWTTPVDKGAIVGSYELNPYDADNVNRYLYDSAVVKDMGNGRWFVDLGKEIVG
GLHLELNSPVSQEITLHYGEEGNAETGDVQWQMNTGNKYEEKWTLKEGEQTIENIGMKTF
RYVEILNVPEGVTLTTDNFKGLAMHQEFSEDESSFNSSDDLLNRIYDTMKYTIKATNQDL
MVDSQSRERGAYEGDVLINQMSSYSFEDDYSLARFSMEYLETHRTWPVEYVLYMVNSTWY
DYLYTGNKDSMMESYEKLKTNLVDCGADKNIVDMGDGTTLVTVNHTNVNQWNSVLVDWPV
SEHDGYNFSSAWYNTVMNAVTYGGFVDMAKIATELGKTDDAKAYQEKADKLKAGMIKYLY
NSETGAVRDGLTKDKQPIDHYAQHATAFALAYGVYEDQAMADKMADYIRSQGKIKTSVYG
SYFVLDGLYRAGAGDVANAMMMDRSANNGDRTWAYMIDTLGATITTEAWNETNKGNMTYS
HPWGSAPGSQIIRGLFGIQPTKAGYSEFQVKLQPEGLEYASIKVPTLKGSVQASFDTRDT
ANAISTTVTIPANTKANVMVPTMGQDHGYVSVDGTITQVEIVDGYYSVELGSGNHTIAVP
NAGKLSAMTSDSSKVYVGQTDKISTIFTTADGEEMDAATVGTLSYESSNPEVASVDAQGT
ITYNAEGSATITVTAELKDVDMQGTPVSYTTSTSFTVSCTNAKVERVYISVDGDLYPNAT
VQATLKGVLESGEEVDLKAASFTVDNPEAFTVDENGVLTGVAPGEGTVIVSMTEGLNDLV
DDFDLDYFAYNEMYSDNFDNGNNTFDGLQVQDGAVVVNKGNKVFYDNEEAKQWTDYTVSA
KVKVTSNAANITFRATDSNTFYLWQFRADTNMLKTHVFSSAHASSQGFQLLGEYPISNLK
AGEYNDITIRVEGNKFTTYVNGEFVNATYNDELTHGSVGVRNGGSESFLMDDLFVGDTQL
VTTLDLTVNEPANKNILNKVIDYAEDQKNSDDFNNVIADVQKSFNAALDNAKAVAADPAA
SQETVDEAWQTLMKEIHKLGFVKGDLTNLKKLIEVADDYDLTKYVEAGQAEFIAALEAAK
AVVADGDNALQGDVTEATDNLLNAMMNLRLKADKSILEEVVNQATGMDLSQYTDESVAVL
NAALEKANAVLADETLTEDQQNVVNDAVDAVKAAMDGLQTKSDESNAGNTSSNGQNNSST
NNGDKLANNTVNAATTGDVAMPIILVVIAVVAAIAIIAAVVISKRKNKNQ

Enzyme Prediction     

No EC number prediction in MGYG000001560_00095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	583	1099	2.1e-96	0.9940476190476191
CBM67	382	557	1.2e-25	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.28e-33	690	1028	1	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.52e-18	411	559	1	161	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.13e-07	585	685	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam01204	Trehalase	1.87e-06	844	972	276	443	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam17390	Bac_rhamnosid_C	3.75e-06	1037	1102	1	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQW20897.1	1.94e-196	342	1138	117	872
QYJ03013.1	3.19e-170	10	1143	9	1058
BCJ57454.1	5.91e-154	15	1098	26	1013
AZM50481.1	8.01e-154	34	1138	28	1036
AKH86459.1	2.12e-153	34	1145	28	1043

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	7.64e-28	38	1145	7	1036	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.80e-22	450	1104	184	850	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3CIH_A	1.92e-15	647	1078	262	679	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	7.94e-10	36	145	31	139	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	4.11e-63	490	1130	513	1169	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
Q82PP4	9.33e-27	38	1139	7	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	5.68e-24	388	1101	172	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	4.61e-20	388	1102	176	880	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	1.87e-17	387	1099	185	905	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999085	0.000157	0.000195	0.000156	0.000137

TMHMM  Annotations     

start	end
5	27
1760	1782