CAZyme Information: MGYG000001560_00405

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_00405
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1754	MGYG000001560_1|CGC6	191902.14	4.1462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 491996; End: 497260 Strand: +

Full Sequence      

MKRNKILALVLAIAMVFTMIMPINSFAASEQETQIVGMKTNDLENPMGIDTPNPIFSWKM
SSTIRGQKQTAYQVVVAKDDNFQNVVWDSQKQTGDVSIGITYAGDPLEAYTTYYWKVTIW
EKDGKQVVSDAATFEMGVLAGGFDDADWIVRGGTYPYPKDLVTLDGANWIWAGSTKTQPE
TAYFRFKFQPDANKTLENAYVAFTADDYGVAHFNGTQIADIPNEGDIWRTGRVIYLTDMI
NPNGENIFTASIVNKQVGDGGLVAKIVLTYTDGTHDIFVTDETWLASNSTNITEDYTSIS
YDDSDRNIWKYPNRANENEVVPYGSAPWYSNVGLPNEASTYSGKVAAPIFRKQFDLDQTA
ENVVNARIYATAAGLYELTFNDKKAGDEALAPGFTQYEDHITYQAYNVTDLIKDGQNTIS
ATIGKGWYLGAIAYEIKGVQEAFIAKMVITYADGSTQTIVTDDSWEYTDDGPILSNDMYN
GEVYDATRTLKPYHYSKVGTTTAEALGIGQIISQISGSVKPMEVLEPVAVTEPKEGLHIF
DFGQNFAGVVELTVNTEAGTQIMMRHAEALNNGEPNADGDPGTLYLGTLRNAKPNDYYTA
KGGGPETYRPSFTYHGFRYVEISGIDLEDIVSVKGIVLYSDMEDTGSFESSNSLVNRLER
NVYWGQRSNFLSIPTDCPQRDERYGYTGDSQVFSDTSGYNMDVKAFFDQYLMSVNDCVFD
NGAFPNSAPGAPPNDRNDPAYNGWADGGVIIPYNMYIRYGDVGIIERSYDKMVNYIEYLY
ADRDENHLRTSQTQYGDWLALDKEETPVALTDTAFCAYVCDLMTEMATAIGKTEDAERFA
GYAQGFKDAWAKFYLKENGQTIVNTQTSYVIGLAFDVVPDEMKQATADQLAAVIQSDKYN
GKISTGFISTGFLLPVLCEYGHEDIAYSLLEDTEFPSFLYPVTQGATTIWERWDSYSPSG
FGNPTMNSFNHFAFGTVARWLYSGVLGITVDPASPAYKHFSLQPVYGGSMTYANGSYNSQ
YGLIESGWKLDGNDFTYNAIVPANTTATLYLPSDKATAIYESGKDVTKEAVEGIEYIGTE
NGKAIFELQSGSYSFSSTVVNKAELEEAISNASNINEFFYTADSYRALTEALAKAQEVQN
NKDATAEQVQQATDLLNSAIENLVPIAQDGSESNPYQINSLDQFKLFANTVNSGDSFQDK
YVELNADIDLSGINWTPIGTSNSTTSGAGFAGTFNGNGHVVSNITIPGTSKYATFGLFGT
VTGTVKNLGVENVTITHDGVADLRAGGLAGTLSGGLIDNSYVINANVSVGGRVAAGFLGL
NRNGTIQNSYAKDITVTGGRTGGFVSDNQDDSGNNKGTIINCYANTSITASSHTGNIENS
RTIENEQFIDGSLVDLLNQGNPETVWEQGETHPVLVVTETPEPPVDTDKTILDKVIVEAN
RLKGTDEYNNAIPSVQQSFDKALEEAQNVYDNPSATQEEVNTAWQTLLKEIHKLGFQKGD
KTALQELYNQVKDTDLSQYRDGAAKENFKTALANAETVLADEEAMQKEIDKAYNDLKAAY
EALEKLADKSQLKELLDECAGYQKEEYTPATWEVFAGIQEKAQEVYENANASQEEVNAAI
DELLSGMLQLRFKADKSILETVIKVAGEIDGSIYTAESYGILQAAVTEANEVMEDENASQ
EEVDVATTRVQEAMKGLVTVETPAENNHADGTQTGQESTTPKANAAKTGDFTPIAGLAVI
TLAGAALLLTRKKK

Enzyme Prediction     

No EC number prediction in MGYG000001560_00405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	531	1051	2.7e-161	0.996031746031746
CBM67	343	489	2.7e-26	0.7727272727272727
CBM67	167	313	5.2e-21	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.87e-114	643	985	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.44e-42	363	523	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	8.92e-32	531	639	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.32e-18	990	1064	2	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam07554	FIVAR	2.14e-05	1432	1494	3	68	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT43619.1	1.39e-225	27	1159	44	1146
SDT43572.1	6.79e-213	38	1161	6	1097
QGH33563.1	8.41e-206	21	1173	29	1258
ASQ98318.1	2.39e-202	25	1095	27	1059
AQW48760.1	3.34e-202	25	1095	27	1059

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	6.08e-194	43	1106	14	1037	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	9.31e-130	328	1052	111	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	2.73e-124	20	1095	14	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6KBJ_A	1.75e-10	164	466	50	331	Structureof Lectin from Pleurotus ostreatus in complex with malonate [Pleurotus ostreatus],6KBQ_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with Glycerol [Pleurotus ostreatus],6KC2_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with Rhamnose [Pleurotus ostreatus],6LI7_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with GalNAc [Pleurotus ostreatus],6LIK_A Crystal Structure of Lectin from Pleurotus ostreatus in complex with Galactose [Pleurotus ostreatus]
6T0Q_A	3.63e-10	164	466	30	311	PleurotusOstreatus Lectin (POL), apo form [Pleurotus ostreatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.47e-193	43	1095	14	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.78e-140	332	1095	154	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.19e-120	326	1075	148	902	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	7.44e-79	41	1064	38	919	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
E8MGH9	7.56e-08	1500	1750	1667	1921	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999096	0.000184	0.000180	0.000157	0.000142

TMHMM  Annotations     

start	end
7	29
1731	1750