CAZyme Information: MGYG000001560_00754

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_00754
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1320	MGYG000001560_1|CGC10	146732.84	3.9794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 913427; End: 917389 Strand: +

Full Sequence      

MKSFKLHRMLSSLLAAALATSVLFAFPAQADEQPLTENWGTSNWIWDGDELDENGLASEQ
DVWMNFRRDFTLESVPEMAKLKIAVDVKYWLYVNGEEVVWEGGVKRGPNPEDTYYDTVDI
VDYLQPGKNTIAIQVWYWGNTVGHNNPSGSGGLLVSSDLIDSNTNQIIETGDGLWWSMRS
PANLKDSHSTSGLLAEYNVLYDGRQEIDWINPDYVPSEVNGWSLAQNIGEDEQDPGYAGD
GPWNDLVERPIPQWKDYGRKPLEFTPVDGYSPQIVTTPISDLGITSNTYSIETDLTLSVV
NILSFKLANISFLFGATDANHYYKAYIDCINYLDGGDKATLYLSDSQKSIANIDISNILT
RENYKDNINIRLDVINEQETNLYLNDVLIYTLTDNLASNQLSFGYAGELSGTGIGAATIK
NITIKGIDGSSYANNFETAEDCSIFQGSNFSNGMQTSELTMLGTLSDNGQKYQAQLPYNC
QMVPYIILDDGTEAGKTIKMYTDTYDLSDEHIAYITKKGAQEFEGKNWINGDFLYFDVPD
GVKVKEVGFRETGYNVPAGENTDFVGYFDSSVNENDPSVAAFTGGHTWTEEEANTDNNFY
DELWKKATRSLYVTIRDQYMDCPDRERGQYIGDAINEIEEAFYSLGPEANAISEKAIRNI
CDWQEVGERNGRTYYFMSNVRPGVLEQEICAQSLGTALAAENYYLFTGDTELVQDTYQPL
YNYLTNYDIMEDGEYSGLISVRTPDTTMYNDFMSNWLDWGNNMDTLVETNAWWYISAKSV
RALADVEGVPATQEQKDWLDERLASIEQNFEKFWNEDLQAYATEWNETDWYQPSELENGS
HVVDDRVNALGVIFGLIPEERYSQMRDVFMGTESTPAYENVSIYMEKYVIQALYMMGYDT
DAMSRIEKRMMEMVNTSTDSTLWELWDRTSGTKNHGWSGGSMIAMSRYAAGVEPTGAGYS
TWHVVPQLGNFEEINTRVPSEIGNIDVTINKTDTTLDMTVVSPGNNAEIWVPVESGQGVV
TSSNAQYKGIKQAYQKDYAVYEISEAGSYTFTATETNKDILDSVIAYAENAKASGEYDNA
IESVQKSFDTALENAKTVAKNENASQEEIDQAWKTLLNEIHKLGFVAGDKDSLASLIEAA
KEIDLNKYVEAGQAEFTTALEAAKGVYNDGDAMQAEINEVADNLLNAMLNLRFKADKSIL
EDVLAEAGKVDANAYTAESYATLQVAVAEANDVYNNENATQEEVDTAVTSVQTAIDNLVA
VDGTPAETPTENKNTAGSQTGQESTTPKATAAKTGDFAPIAGLAVITLAGAVLLFIHKKK

Enzyme Prediction     

No EC number prediction in MGYG000001560_00754.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	582	1005	6e-56	0.7638888888888888
CBM67	42	233	1.2e-29	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07554	FIVAR	2.51e-06	1200	1259	3	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.
pfam07554	FIVAR	1.93e-05	1061	1123	3	68	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.
pfam17389	Bac_rhamnosid6H	0.002	594	940	7	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.003	693	817	341	465	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEV28934.1	8.56e-112	10	1054	10	798
AXE90460.1	7.33e-110	41	1054	41	798
QYX75380.1	3.58e-109	10	1054	10	798
AYC36171.1	2.20e-107	41	1054	41	798
QTU58279.1	4.14e-107	10	1080	10	821

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH9	9.38e-10	1052	1314	1669	1919	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1
P26831	1.18e-07	983	1255	1266	1565	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000684	0.998078	0.000297	0.000419	0.000261	0.000227

TMHMM  Annotations     

start	end
1297	1316