CAZyme Information: MGYG000001560_00821

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_00821
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1587	MGYG000001560_1|CGC11	176081.63	4.2256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 994020; End: 998783 Strand: +

Full Sequence      

MKRRITKVLISLTLAAGIAIQGAIPVFAIDGDHAAAISAVHLKTEYQTNPMGIDMDAPTL
SWEVDSQARAQVQSAYQIKVADESGDIVWDSGKVESNETTGIEYEGEELSPMQKYTWNVR
VWDKDNAVSDWSEQASWETGLTEEQWKDADWIGKASSVASPESLNLEESNWIWVLNGTDY
KYVPGETRYFRKTIAPNTEKSVQKVLLAFSGDDYGTVYVNGTQAAAIEGANAWRKGDAVD
ITNLFTAGQNQISAEITNASKGYAGFIAKVIIRYNDGTNDIFVTDESWKSSLTPEEGWML
PTYDDSSWEIPDQVLTYGVDPWKKQVNLPQIEDDNSKVFDAAPMLRKEFSVQDKKVKSAR
AYITGLGYYELTLNGERVGDNMIDPLVTRYNQRYFYTTYDVTDQLLASENTIGVTLGRGY
YGTIGNGMNWQTNGWSKAPWADQPKLRMKLCIEFENGETMQVVSDESWKTHDSATIFDEP
YYGEVYDARLEIPDWDKPGFDDSQWEQAVLMEAPTGTVEPQAADANKVVDEVHPVSMTNP
KEGVYVFDMGRVVTGWAELNVQGNAGDMVTIQYGETLTEEGTLNRKDLVNDWDVDGFVKQ
ASSDYYILKGGEEETWQPRFTYKGYQYIQVSGYPGVPTLDSITGKVINADLEETGEFSSS
NEMFNKIHEIGKATLLNNLHSYPSDTPVYENLGYLGDGHLTQEMGMYNFDMVRYYEKWAN
DIRDQSKENGYMEQTAPMWNETKDNAPEWSAAICLVPWQNYQISGNKRTLADNYQTMKTV
FSYQRSLMKDNIADSMWGDHANVSGNRITPITATAYVYYMADIIAKSAEVLGYTDDIDYY
TQEAETIKEAFNNKFYDEEQGFYCLNKGGTFYQTAQALPLALGMVPEEVIPHVVYEFSSR
SSKMESGIFGIKYVFAELTEAGYGDIAYNIVNTEEYPGFGYWLSKGATSMWECWTEGTRS
RDHHMFATIDDWFYKTIAGINYEGAGFSTSVIKPYVVGDLTNAQASLHTVRGKLSSAWSR
TEDGTFSLNIEIPANTTATVYVPTADQNTVFESGIAADKAEGVSFLRMNNGFAVYSVGSG
RYSFTSKYAAPEPIGKPGEEDKHTYVVDEFGDYNSMFTDSTGLRFDTANTDKYFFGDGTR
ICRTSLSEKEIVYYLSDDIKSINLVTFTGKNSDWKNDFAFSVSSDNSTYVPLEIQDATRE
GNTSWVRITYQFDQIPEGMRFFKIQFKPMTGNAWEPQLAKLTVDCGVENPQFLTVDKRVL
QKAFDETSLIDLSIYTEETANQLKAALEQADKVLQNTSATQQMIDDAVEALQQAVDGLIE
KPQNVDKSILNAVITYAENAKASGEYDNAIESVQKSFDAALENAKTVAANAGATQAEVDV
VWRTLLNEIHKLGFVAGDKTSLTSLIKVANGINAKLDLYVEAGKPEFTAALEAAVAVYED
GDAMQAEINIVADNLLNAMLNLRLKADKTILQQVIAEANGKDANAYTAKSYGALQAAVAK
ANEVMADENATQDEVDVAVTNVQTAMDNLVAVDGTSAETPTEDVVQTGQESTTAKANAAK
TGDVAPIAGLAVITLAGTALLISRKRK

Enzyme Prediction     

No EC number prediction in MGYG000001560_00821.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	538	1041	2.9e-146	0.9940476190476191
CBM67	340	514	5e-40	0.8920454545454546
CBM67	169	322	3.3e-31	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.74e-82	652	977	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.21e-64	354	530	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.22e-30	541	647	4	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.56e-18	979	1046	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.98e-06	240	308	47	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS56111.1	4.20e-269	88	1085	15	1015
QYJ14959.1	6.44e-247	30	1084	30	1079
AEK42215.1	4.33e-230	17	1086	19	1060
AFO77158.1	4.33e-230	17	1086	19	1060
AGT84286.1	4.33e-230	17	1086	19	1060

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	4.34e-173	35	1090	2	1034	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.83e-162	31	1084	18	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.82e-76	285	1043	92	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6T0Q_A	2.61e-19	138	329	141	351	PleurotusOstreatus Lectin (POL), apo form [Pleurotus ostreatus]
6T1D_A	2.72e-19	138	329	144	354	PleurotusOstreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_B Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_C Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_D Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_E Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_F Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.62e-171	35	1085	2	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	7.58e-121	47	1054	40	918	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	3.66e-92	39	1089	35	925	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.89e-85	49	1050	42	885	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	5.97e-26	483	1054	549	1148	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000460	0.998553	0.000278	0.000256	0.000216	0.000204

TMHMM  Annotations     

start	end
7	29
1564	1583