CAZyme Information: MGYG000001560_01355

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_01355
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1382	MGYG000001560_1|CGC20	155116.62	4.1687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 1626535; End: 1630683 Strand: +

Full Sequence      

MKKRVKFMSLLLAGCLCLQCTGMVSFAKSETSGNQLWSAFQTPPDSSKTRPLWFWNTELD
EMTPEKVRELVRESYQQSGYNGFGILPNWISQYLSDNYFELYEAALDEGSKYGMHFSLYD
ENGFPSYNAGGLLEENYPELTTKRLDKFEQDASNGEKVYLSLPEGKLMGAVAMNMDTMER
IDISDQATIVDPPPFSPDTQPLGVSASSTYSVTSGYEASKAVDGELSTRWNAESLSGGGE
YLQINFGEEKTFDSVKVYEDKLEELHRTKDYSIQYWDIAENRWKTVATGTKITDQGATHS
FEPVTAQLVRLYIRNITQDSASISEFQIFNGNQQLEVPPTPLVPEKAGYSASSVYEIEAG
YEADKAFDGDMTTRWNAAARGTAPQWLEISFGEVRNVNKAVLYEDLDRITSFHLQYWNGD
SWVDCATGSTIGSAGLTLNFDSVQTTKMRLLMDGLNGMSPTIWEMELYDGNTKIQINEDQ
QQPESSHLEYTVPDGSWKVMAFMCVKDGNNGMDYLDADSVRAFIDITYEEYYSRFQKYFE
NGTITSAFYDEPTFWPWPGTTPYGAEGARLWTPEYNKAYEETFNGESPVLNYPALWYDIG
EDTDEARNKLQYVRTELFAENYIGQIADWCDDHGIDLMGHMLLEEWVNPVGLHGDLMKVF
KDQQIPGVDVIGSYGYTQEAYKIISSSANNWDKGVVMSESFGAMGENMDKNILYKSSMDQ
YAKGVNMIIPHAIWYDNINHVDAPPELSYRNERYREELPIYNNYMGRLNTMLQDGRHVAD
IAMLYPIDYLESSFIFNGDANNPSDADYMRVGETLSLTARRDFTYLHPDIIDERCSVDGD
TFHLENETNYEDYKVFVIPGTKVISLSNLEKIKDFYDNGGKVIATTQLPYRGIEDSENEQ
VISIIKEIFQVDPVTGQSLASSTGEYTKNTNAAGGTAYFIQTGFETKLQTVLDDALPTYD
VEIDQVPAISGGNLSYIHKVKDNQDIYFIANSSDTAMNITVSLHGEMEQPMLWDPMTGTK
QAATFTVENGITKVQLSLTGIQSMFIVDETQPVVEETDKSILQTVIQYAENAKTTDEYTN
AIPSVKDSFDKALTDAKAINDNDSATQEQIDTAWRTLLNEIHKLGFQVGDKTKLQALYDE
MSKVDLDDYKDAVSKENFVKALEQAATVLADPNTMQKEIDKAYDELETAYSLLEKAADKR
QLKALIEATKEYQQEEYTENTWGIYAEAKAKAEEVYNNVDATQEEINEAADNLLAGMLQL
RFKADKSLLEEVVEEAKGIDLSQYTVESAATFQVLLAEAQEMLNNNDLSKEDEGAINAKA
MELKAAQSKLEPIRTAGSEATQTVQESATPKADAAKTGDVVSITGLGLLISGISLLILRK
KK

Enzyme Prediction     

No EC number prediction in MGYG000001560_01355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	511	1072	2.8e-59	0.6322815533980582
CBM32	205	327	6.3e-20	0.9435483870967742
CBM32	351	465	7.2e-16	0.9274193548387096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17132	Glyco_hydro_106	3.86e-30	488	1026	366	872	alpha-L-rhamnosidase.
pfam00754	F5_F8_type_C	5.26e-16	204	326	2	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	1.49e-09	350	432	3	87	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07554	FIVAR	5.44e-06	1062	1124	3	68	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.
COG1196	Smc	4.53e-05	989	1322	618	970	Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61176.1	0.0	1	1059	1	1057
QGT72311.1	6.34e-122	484	1048	183	723
QGA23530.1	7.68e-122	469	1048	168	730
BCG54873.1	1.55e-116	488	1049	186	750
AWW28862.1	1.19e-113	488	1049	192	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RV9_A	2.71e-09	359	468	22	135	Solutionstructure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
4ZXE_A	2.78e-09	359	468	23	136	X-raycrystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis],4ZXE_B X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis],4ZXE_C X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis]
4ZY9_A	5.15e-09	359	468	23	136	X-raycrystal structure of selenomethionine-labelled V110M mutant of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZY9_B X-ray crystal structure of selenomethionine-labelled V110M mutant of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
6Q2F_A	7.12e-09	567	1047	508	965	Structureof Rhamnosidase from Novosphingobium sp. PP1Y [Novosphingobium sp. PP1Y]
2RVA_A	5.27e-07	351	468	13	136	Solutionstructure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNA8	2.28e-12	567	1047	306	737	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22040 PE=2 SV=1
P26831	2.83e-09	1126	1312	1357	1553	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q9L7Q2	6.43e-07	1130	1288	417	575	Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005206	0.476263	0.513415	0.002710	0.001407	0.000973

TMHMM  Annotations     

start	end
1360	1378