CAZyme Information: MGYG000001560_01730

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_01730
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1764	MGYG000001560_2|CGC4	196424.2	4.1236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 324941; End: 330235 Strand: -

Full Sequence      

MKKRWTRFLSGLLTAAMLSTVVVFAPTSFAAEATLSVQEMKVNSLSEPLGIDQLPKFSWG
YFSNINGKEQTAYRIIVASSQEKAEAHEGDIWDSTKIESSQNFDIPYEGTDLASKTEYYW
AVECWDENGQSIGWSEVSRFETGMLHPEDWTAEWIGDDIIGNTLSTTVDGCYWIWSLNGS
PFDQAPAGHHYFRKTFSVNPNKTVKQVIFGFTADDQGVFYLNGEKIGQTQAWESGGVYDI
TDKILSGENLIALDGNNTSQGYGGVIGKLTIAYTDDTTDTVITDNTWKVNGIGDSGWEQP
GFDDSNWVTPDQNVLYGGDPWGTRVVMEVTNTEPVSAPIFRKEFEVKQEIESARAYICGL
GLFDLKINGENPDDTVLNPAHTQYNKTVMYRVFDVTNQLQQGSNAIGVELGKSFYNETVT
TWNWQNAVWRDNPKLLMQLEITYQDGSKQIVDTGTDWSVTSNGPTVFDSIYYGETYDARL
EKTGFDQPGYKEDDSWHSAVNVDAPTGKLIFQQMEPMRRAETLDTTVTKLDSDSYIIHPE
KMTTGWIKLNMGNLPEGTEVTITYGEKLNADGTLAAQGNDSWFIRTIQQDKYIAKGEPGE
NFEPRFSYKGYEYIQVDGYLGELTSDQIEAYAIHNDVGIPSSFESSNEMINSMHDVMVNT
LLNNFQGKPTDTPVWEKNGWTGDANVSTESMAYNFDMRLFLSKFLNDMEDTQTETAIGNI
APSADWSIENTPVWNGIYFLGTEQLYNQFGMKSFVEEQYDAMRKMALVDIKTIQNNGWVW
FDTQMGDWVSPYGGTDPNAPGIAMSPEGSAICGTGYVYQILKTMTHMAEVLGKEEDAAEY
RAAMEQIYTAFNEKFFDEEKQIYDTNYWIPENAGLRTKFRQTSQLVALAFGLVPEEYKDA
VVKNLVNDIVEKGYHFEVGMVGNKLLLPVLSDNGYNDVAYKVLTQTTYPSWGYWLEQGAT
SAWEGFENTTRSHNHYFLANYEEWLYKGLAGIRDFADGGNTFTIQPQLAGSLEYVDAVTN
TAYGNIRSSWKITEQNTEFSYQIPVSTTATIYLPTADTIYNKDHQEISTSDVGIVSIEKQ
GEITKLVVKSGNYQFFCNTNQTVYKDDLRDAISYADSLQQEDYLQEAWTEFQQVLEQAKS
VESQQDTNQIAVNQATNSLEQAIEVLTNKVDTVRKNLKELLQSMSTLSKADFTDHWEDFQ
AVYEKASALSTDIQATTEQLQKVTDELNQAYELLRYYRTGNIALNSTPTASSSVNGSNGW
DIRNLTDGDLKNLSSINEICGWTSNNDINNNHTEWVAVDLGTINRISEVVLYPSGIDANN
NAYGMPIDFTIDISDDGINWTTVHTEQNYPLPTSDPQKFVLDQSYFARYVRVHATSLRPK
PSDNNLYRMQLVEMEVYNHPVTDAQLTGITLSDGNLEPTFDPSVREYRVEVANDVESILV
TPSISQGGSVTFDDSDMLGKDEATGKYLLREGENQLILHVVTEESQAVQSTSITIIREKS
EVVDTDKSILNAIIKYAEEAKTSGEYDNAIESVQKTFDAALENAKAVANNAAATQEEVNA
AWKTLMNEIHKLGFVAGDKTALASLIEAANEINAELDRYVEAGKAEFTAALEAAQNTYNN
GDAMQAEINEVADKLLNAMLNLRYKADKSILEEVVAEAEKVDANAYTAESYAVLEAAIND
AKAVLENENATQEEVDTAVANVQSAMDSLVAVEGTETPSDNSAAQIGQESTTNAAKTGDT
TPIAGAVVAMVAGAVLMTIRKKNK

Enzyme Prediction     

No EC number prediction in MGYG000001560_01730.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	527	1053	7.4e-137	0.998015873015873
CBM67	173	321	6.7e-32	0.9829545454545454
CBM67	332	506	7.7e-32	0.9147727272727273
CBM32	1250	1393	1.8e-19	0.9193548387096774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.92e-90	641	989	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.21e-60	349	521	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.84e-19	528	634	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam00754	F5_F8_type_C	1.90e-15	1249	1376	3	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam17390	Bac_rhamnosid_C	9.20e-12	991	1057	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59736.1	0.0	3	1412	2	1429
AQS56111.1	2.63e-225	77	1108	1	1027
QYJ14959.1	3.33e-225	11	1095	8	1079
QFZ72212.1	1.57e-203	33	1054	34	1032
QIY67161.1	4.61e-201	33	1054	34	1032

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.98e-135	39	1096	34	940	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.10e-124	33	1054	2	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.30e-77	319	1054	109	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6T0Q_A	2.50e-07	170	288	197	311	PleurotusOstreatus Lectin (POL), apo form [Pleurotus ostreatus]
6T1D_A	2.53e-07	170	288	200	314	PleurotusOstreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_B Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_C Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_D Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_E Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_F Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.28e-123	33	1054	2	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.01e-104	32	1098	27	950	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.04e-91	341	1095	178	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.69e-72	341	1054	174	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	2.74e-15	584	1054	675	1127	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000300	0.998999	0.000166	0.000195	0.000166	0.000149

TMHMM  Annotations     

start	end
9	31
1740	1759