CAZyme Information: MGYG000001560_01882

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_01882
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1502		163795.36	3.9335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 493539; End: 498047 Strand: +

Full Sequence      

MKKTKMKIAAFVVAAAMATTMVPATLFASAAPDVSTTIVNMKTDGLVNPLGIDDTVPEFS
WQMDSNVIGAKQESYHIVVKDKKGAVVWDSGIVKDSKSTFIKYAGDALDAKSTYTWTVTV
TDENGKTYTSDPAIFETGLMSTSQDAWGGAEWIGADELTFDATSACYFDLGTTITIPEGN
TKASLILGANDFRLNNEYFNIWRDGGENYFKYEIDITDPNAAKLNIYVVGMPAMLPVFDE
NGDPVMEDGWGGPTQKMEAQEVENDPSVPDITIDISKVINAENAHQPITISVDTASQESS
KVTCTINGTVVDNGRQLNPLGAGGNYNSFPNVNSVGFAVPAGETATYSNFEIRNPGPYST
GMLFDATTGATYDIFKGLDGVTVNDDNTITVGKKDADVLAYADPSYGSAPMLRTEFNADK
EIASAKMYVTAAGIYEMYINGERMGDDWFNPGNTEYREEMAYHTYDVTDMLKQGENAIGA
KLGEGWWSGYMSFTASNYNYYGDKQALMAKLEVTYADGSTETIVTDDATWDYYGDGPVEY
GSFFQGERYDATKEAAIEGWDEAGYDDSQWRDAEVIPFRAQFDDFDMVTRYDEPAGIVNE
IPVQEALGESRPGSGSYIYDMGENVIGVPQITIPEGYVEEGQEVTIRYAEILYPDNLEEY
TSADIDGLLMTENYRAAMSTDFYTAKAGENVIEPHFTFHGYRYLEITGLKKELPADCIKT
LIISSVDTTATYDSSNALSNRLFKNVQNSQTSNFLSLPTDCPQRNERMGWTGDAQVFSRA
ASYNADVYNFYRQWLNSLRAEQGEAGDLPVYAPAFGSYDLEDTSSEVGTGNPGGFNGVSW
DAALTLVPWQMYRQYGNPSIIEDNIDAIYKYLNYLDNNDMTYTNEDGEQVTEPSLTSKTG
FLADWLSRVSTDAALINNGVYIYLMDVASQMAEVVGRTDMAVELRTRYDTAKEAWNRIYV
DPETGKTKTPNGKIQDTEASYATALVYNVFNEANKEKAAENYLNTVKNPDQSFVDDNGNI
KPYTITSGFSGTPNLVPALTQNGYIDDAYKLFESTDYASWLYPVTQGATSVWERWNSYTV
ENGFGGNNSMNSFNHFSLGAISEWMMGYQLGITGDDANPGYQEFILQPTVGGSFTYANGS
FESNYGEIYSGWTADNGTMTSYEAVVPANTTATLYLPVSEEAVAEFENIAGVTYEGMTIN
NETTVAKFTVEAGGYNFALQDGKLVASIADGYVADETETADKGILNSVIEYADAAKASSE
YDNAIESVQKSFDEALTNAKAVAENDAATQEEVDAAWKTLLNEIHKLGFVAGDKKELASL
IAAAEEIDLSKYVEAGQAEFTTALEAAQSVYKDGDAMQTEINEVADKLLNAMLNLRYKAD
KSILEEVVAKANQIDANVYTAESYAVLEAALKDANAVLANENATQEEVDTAVENVQSAMD
GLVAAEGTETETPTTDNNATQTGQESTTTKANAAKTGDIAPIAGMAVLAVAGAAILITRK
KK

Enzyme Prediction     

No EC number prediction in MGYG000001560_01882.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	612	1176	2.3e-139	0.9920634920634921
CBM67	406	576	2.9e-33	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.21e-92	727	1108	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.43e-56	420	578	1	155	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.31e-22	611	724	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.17e-16	1119	1184	7	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam07554	FIVAR	1.17e-05	1384	1443	3	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH33563.1	1.87e-298	35	1217	39	1182
AHF25035.1	1.30e-296	36	1224	21	1231
QGH37059.1	5.97e-276	38	1217	32	1180
AOZ98905.1	5.64e-261	38	1217	25	1177
SDR84497.1	2.02e-257	30	1260	37	1245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.95e-125	49	1228	17	1036	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	9.34e-95	395	1177	113	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	3.11e-89	409	1220	176	942	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.53e-124	49	1219	17	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.35e-122	394	1217	159	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.81e-109	391	1184	151	886	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	6.42e-63	408	1223	183	944	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
E8MGH9	6.29e-08	1236	1498	1662	1921	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999045	0.000167	0.000207	0.000164	0.000148

TMHMM  Annotations     

start	end
9	31
1479	1498