CAZyme Information: MGYG000001560_02012

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_02012
• CAZy Family: CBM66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1707		186183.64	4.2258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 665127; End: 670250 Strand: -

Full Sequence      

MFMKKGVKRMSALLLSAAMLSTVLVAPANAQDGVNAPMPYGLLTNELEKPLNVEAPTFSW
WNQDADLDDVQTAYQIIVKDDLTDEVVWDSNKVESSEQSNIPYAGPELDPAHPYSWTVTT
WDSTGLKGTSEPASFATGLSDEDWNASWIQKPGTPVTIESSGTAAHVQGGGLTMYSAGTG
WANYNLNVDVNAEKGAAGVAFRAADSNNAYIWSLVPGKGLTKTALVNGEKKDLGTVEMDI
MENAYYSMNIVANGNTITTSIDGIQVDVTTDDIFATGSVGFYEEEGQVGNFQKLSAQSIS
KQIESIKVVGGKSSDKQVILNNQGYDWTDYTLDFDMQINNTSDDATAVMLRSSSDFKTGY
MWQFTRKKKGLARHTMTNGKFNKIDGDGAVSYSFKADTYYHITIEVKGNTIKTYIEGELF
DTYVDEKNTSTKGTFGFRNTNAEGGTFKNIKVTGADGSELMVEDFQNLDNYITSDGKPAT
TITTNDNTQTYLSTDFSKGFDGWSNTTVMSQVDGYNWANCNTNGVILAKTGTDWDNYTVS
MRVIAEKTAAGIMFRATDKDSGYMWQIVPGTGLKVHVQENGKFTALKDPIKYDIKEGQAY
RVTIDVNGDTFKTYINGTLVDTTTDSTYSKGTIGFRESTTGTEVGKFSEVKVTGADGTIL
LEDKFDNGMSQWNGDTVPATGSNMYWYARKEEKLEEGKEPVKALAYMASAHDYELSINGT
RIGRGQSFDYSDETHYQGWDITEALGDDDTISIGVLDRWYSGGQGRAAGKPGLLGEIVVY
YNDGSYQTISTGEDWVAEDAPLSGSTKRNGEGDFVEEYDARKAIDNYSEVGFDDSSWQNV
YVLGEHPTDPFTNVQSELGHVTEETVQPETITTLEDGTTIVDFGRVIPARFSVNFANGKA
GQKLTLITGYELKDDGKVNTSGSSSQNTNMNFIYTQKDGAQTYNTWDHLAFRYLQIPNVG
QTFTKDDITATILYQEVPEDRDSTLITSDEMLNQVYQLMKDSALYSAQNQFVDTPTREKG
QFLQDSVNISAITTTSLYERATSRKAIMQFFDSANRYWNSGDDLGRYNSVYPNVDNKRDI
PDFSLNVPIWIWRYYMQTGDRELLEVAYPYLQNTADYATRAIATEGATAGLVTNLPGGSG
QYKYGIVDWPAPGRFNYDMKAAARTTVNALSVRVFDVVADVAQELGKDAAEVQDYTTRAE
NLKKTMNEKLITEDGVYCDGLMSDGTQSTHNGQHSTSYALAFGIAPEDKIDSMVDYVASM
GMKQGPMTADILVQALFDNGRADAALKLLTNTEDYGWAQLIDQYDATFTWEQWQHGESQS
HGWGAAAGAEMLENILGVTVTEAGAKTVTIDPARDILDHAEGRFATERGFVEVAYSGSGE
DYTLKVTVPTNVEATVVLPKIEGGQFVDKNGNSGTSTFTETEQLVTVGGGTREFVFQKNV
EANKGILNTVIDYAQQQKDSDEFNNVIADVQASFTAALDNAIAVRDNTTATQKEVDAAWQ
ALMTEIHKLGFVKGDITSLETLVSVAEGFDLSKYVEAGQAEFKEALKAAQDLIADKDNAM
EAEIQTAEDNLLNTMLNLRLKADKSILEEMIATANGMDANAYTSESYSVLTTALAKANDV
MADDNATQEDVDAAANAVKAAMDGLVAIDGTEVQTPSTENNATQAGQETTTTKANAAKTG
DVAVPAAVIGLLAASAVAVGITKKRKK

Enzyme Prediction     

No EC number prediction in MGYG000001560_02012.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	871	1398	2.4e-102	0.998015873015873
CBM67	681	850	4.3e-30	0.9261363636363636
CBM66	506	637	2.3e-18	0.864516129032258
CBM66	159	288	1.8e-17	0.864516129032258

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.71e-32	980	1335	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.26e-23	700	848	3	157	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.48e-09	1337	1411	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.42e-07	872	974	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06439	DUF1080	2.93e-07	498	635	9	167	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVT37928.1	2.18e-215	665	1406	139	892
AVT31771.1	1.65e-214	665	1406	139	892
APU21677.1	4.67e-213	664	1435	138	919
APU15617.1	4.67e-213	664	1435	138	919
ASO20813.1	7.00e-209	664	1435	137	918

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.25e-32	668	1399	288	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	5.69e-32	698	1438	187	943	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.70e-29	689	1408	135	855	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	5.73e-12	932	1403	486	947	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	5.47e-33	876	1407	604	1145	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
Q82PP4	1.21e-31	668	1399	288	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.50e-20	687	1399	172	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.74e-10	42	149	35	152	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000275	0.999064	0.000161	0.000189	0.000157	0.000136

TMHMM  Annotations     

start	end
1682	1701