CAZyme Information: MGYG000001560_02178

Basic Information

• Species: Massilioclostridium coli
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilioclostridium; Massilioclostridium coli
• CAZyme ID: MGYG000001560_02178
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1488	MGYG000001560_3|CGC2	162744.74	3.9033

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001560	2985330	Isolate	not provided	not provided

• Gene Location: Start: 90094; End: 94560 Strand: +

Full Sequence      

MAKSLKTRIVAVVTATALLGSMLAATNVFATSTERLELVNLKTDGLVQPLGIDDAQPEFS
WQMDSNIIGVNQQSYQVIVKDNNNNVVWDSGVVKDSTSTFIQYEGTELQPKTQYTWTVTV
TDDAGDTYTSEPQTFETGLMDTTRTSWDGAEWIGADELTLDATSAALFDLRTDLTIPEGS
TKASVIFGADDFRLNDEYLNIWRKGGENYIKYEIDVTDPNAAKLNIYVVGMPAKGQEVEN
DAAEVDYTIDISNVINAENAHAPHNIRIATVNNINNIDCVIDDITVDSKRTLNVLGSGHN
YNSFPNLNSIGFAVPAGETATYSNMTVENMGYGTGTLFGAEIGATYDIFNGLDGVTVNDD
NTITVGKADADVLAYADPSYGSAPMLRTEFNADKEIASARMYVTAQGIYEMYINGERMGD
DWFNPGNEEYRERIAYHTYDVTDMLQQGENAIGAQLSEGWWSGYQTYTSSNYNYYGDKQA
LMAKLEITYTDGTTDTVVTDDATWDYYGDGPVEYGSFYQGERYNALKEQDGWSTVGYDDS
AWRDATVIETREAFDDYELVTRYDEPAGIVNEIPVKEALGESRPGSGSYIYDMGENVIGV
PQITIPDEYVDEGQEVTVRFAEILYPDNLAEYTDADIDGMLMTENYRAALSTDFYTAKDG
DNVIEPHYTFHGYRYLEITGLKKELPAEYIKTLVLSSIETTATYDSSNALANRLFKNVQN
SQTSNFLSLPTDCPQRNERMGWTGDAQVFSRAATYNADVYNFYRQWLVTLRDSQGENGSL
PVTAPSYGKVTDGEVQVGHPGSGFMGISWDAALTLIPWQLYRQYGNTGIIEENIDAIYSY
LNYLDANDMELAQPDGTKVAEPSLTSKTGILADWLSRVSTDASLINNGVYIYLMDVASQM
AEVVGRTDMATELRTRYDAAKEAWNRIYVDPETGKTQSAPSIGRDGSYTPPTIQDTEASY
ATALVYNVFNEANKAKAVENYVNIVKNPDPTFEDDNGKIPAYSITSGFSGTPNLVPALTQ
NGYIEDAYKLFEQTEYASWLYPVTQGATSVWERWNSYTVENGFGGNNSMNSFNHFSLGAI
SEWMMGYQLGITGDDANPGYQEFILQPTVGGTFTYANGSFESNYGEIYSGWTADNGTITS
YSTVVPANTTATLYLPISEEQAATFENIDGVTYEGMAVNNETTVAKFTVEAGGYDFTITA
DGVSASIKDGYVSRDSQPTTNKGILNTVIAYAENAQASEEFENVIADVQKSFTTALDNAK
AIAANDDATQEEIDAAWQTLLTEIHKLGFVKGDITSLQQLVTLGESYDMNDFVQAGQAEF
KEALEAAQAILADKDNAMQAEIETAETNLLNAMLNLRYKADKSVLESVLAEANGKDASAY
TAESYAVLTAAVAEANTVMENENATQEEVDAAVQSVQTAIDGLVAVDGTVPEETTPSTDD
VATQTGQESTTTKANAAKTGDFAPIAGVVALMGIAGVSAMVLRKKHNK

Enzyme Prediction     

No EC number prediction in MGYG000001560_02178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	584	1155	3.7e-140	0.9920634920634921
CBM67	381	549	2.7e-34	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.41e-92	699	1087	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.70e-47	394	571	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.62e-22	583	696	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.53e-16	1098	1164	7	72	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam07554	FIVAR	6.62e-05	1365	1424	3	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH33563.1	5.09e-314	31	1245	35	1241
AHF25035.1	2.86e-301	38	1204	23	1232
QGH37059.1	6.48e-285	26	1196	15	1180
AOZ98905.1	4.09e-264	36	1199	23	1181
AIF65800.1	1.08e-261	34	1196	21	1159

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.73e-137	36	1198	4	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.29e-97	369	1156	113	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.04e-96	383	1196	176	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.51e-136	36	1198	4	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	7.31e-123	386	1196	177	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	7.81e-108	365	1156	151	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.71e-63	382	1182	183	930	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000460	0.998636	0.000189	0.000299	0.000217	0.000179

TMHMM  Annotations     

start	end
9	31
1460	1482