CAZyme Information: MGYG000001561_00090

Basic Information

• Species: Caecibacter massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Caecibacter; Caecibacter massiliensis
• CAZyme ID: MGYG000001561_00090
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		37982.22	8.6069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001561	2649330	Isolate	not provided	not provided

• Gene Location: Start: 102801; End: 103811 Strand: -

Full Sequence      

MSSSVIPVLKKAYPDSEIVYLATANLAYVVSFFKGIDQVIPYTYQSKGGYMDVYRMGKML
RKYNFDIGISLDPRERVTLMKWFAHIPIRISMEQALGWKLGWEKWFYTYDLSFSDGWNYR
EHRMSESFQHLMRLYMNDSEIKFIPPAFCPSDDSDIKKAIELLKPAGIGKKKIAFCVSTT
DEFKDWPADRFSIIADWLIEKYNSVIIMTGVPKHSKKVSEVITRMVHKDSCIDAVGKTSF
SELIALFRHVDLVLTLDTGTSHIAGAAGCPVVTIFTHNTPEIYRAAGKYTGAVSANLPCS
GKHICIGPGKCKKNDCVEAVSVSMVQKEISRIMEMV

Enzyme Prediction     

No EC number prediction in MGYG000001561_00090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	55	316	2e-37	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	5.05e-37	1	332	17	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.06e-36	1	331	15	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	3.13e-29	53	318	1	243	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.09e-10	1	275	21	288	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	6.12e-09	1	281	16	293	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB82130.1	1.90e-250	1	336	19	354
AEQ21322.1	4.28e-135	2	334	29	361
BBB91611.1	2.18e-34	1	334	25	351
AOH48991.1	6.36e-33	3	299	11	301
BBB91590.1	3.09e-21	1	333	19	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.97e-14	1	283	24	295	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	1.41e-11	4	280	27	286	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001561_00090.