CAZyme Information: MGYG000001561_01819

Basic Information

• Species: Caecibacter massiliensis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Caecibacter; Caecibacter massiliensis
• CAZyme ID: MGYG000001561_01819
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191	MGYG000001561_2|CGC11	22414.73	9.0135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001561	2649330	Isolate	not provided	not provided

• Gene Location: Start: 1957766; End: 1958341 Strand: +

Full Sequence      

MRRRNNTKVKIVAAVLVACFSASYFFTWKDDVMRKIVYPLQYDYMVRQYAYENHVDPALV
AAVILVESKFDRSASSHRGASGLMQIMPDTGKWIAEKMGMENFRPAQLNDVQTNIRMGTW
YLAYLLKEYDGNEALALAAYNAGRGHVDSWMDEYGWDKNFKKIEEIPFTETREYVRIVLL
NERQYKKLYNF

Enzyme Prediction     

No EC number prediction in MGYG000001561_01819.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	184	2.4e-31	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.82e-80	39	183	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.18e-61	38	188	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.09e-41	57	179	1	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.76e-34	10	190	98	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.84e-30	46	156	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB81730.1	3.94e-139	1	191	1	191
AXL22000.1	6.03e-109	1	191	1	191
AVO73570.1	9.13e-104	1	191	1	191
AVO26251.1	9.13e-104	1	191	1	191
ALG43012.1	7.49e-103	1	191	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	8.13e-27	34	189	404	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	8.22e-27	34	189	408	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	8.34e-27	34	189	414	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	8.41e-27	34	189	418	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	8.52e-27	34	189	424	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	7.26e-22	38	186	476	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	1.83e-21	38	186	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.83e-21	38	186	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31608	3.97e-18	43	176	61	173	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.37e-16	38	181	1418	1540	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.477715	0.013921	0.500299	0.000089	0.000077	0.007910

TMHMM  Annotations     

start	end
9	28