CAZyme Information: MGYG000001562_00329

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_00329
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		98154.32	4.79

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 153496; End: 156126 Strand: -

Full Sequence      

MNVVNFRNAGCWLVLCCLPLLAGSCGKRPAIADMRCEYLVSPISVDTPSPRFTWIYEDAD
AFEQAGYRLCVATAPEKLGAPDVWNSGEVAGSRPFAAMPDGGLLASRTPYYWQVEAWDAG
GRRIVSPVAEFETALMETSEWQARWISDAHDKDFVPAPMLRRAFDVRSGVELARLYVSAA
AYAKTSLNGEPVSGNLLDPGYTHYDKRNLYAVHDVTDRLREGENVLSAVLGNGFYNAIQP
VATWSFEVARWRGRARMICELHIDYADGTHEVVCSDGSWRTTADGPYLSNNIYSGDVYDA
RREIPGWDRPGFDDSAWAQAVEVAAPSPLLKAQSMPAVRAAREMEPVKVRSFGDTVWVFD
FGVNLTGLCRLQVEGGRGTQITMTHGEFLQPSGRIEMRNLDIYYKPLPGYDFQTDTYILK
GEGRETWTPDFTYHGFRYVELRSSAPVKLDKTSLTARFMHTDVPSVGKFSCSNGLFNRIW
EMTRRTYLNNLTSIPTDCPQREKNGWTADGNLAMELALLNYDGIAFYEKWLDDFVDNQNE
AGRIAGIIPTAGWGYDDWIGPVWDASAFMIPYTLYNYYGDLRPVEKMWPVCARYLDYLAT
REEADGSVTYGIGDWVFYHTQTPTDYTSTCYYYYDNVLMARFAELLGRDGERYARKAAQL
RELINTKYYDAEKGLYANGSQAAQGVALYLGIVPEGDAQRVADNLARMIADNDYFLDFGT
IGSKTVLRMLTRYGHVETAYKMAAQTQAPSWGWWVTQGFTTLAETWTLSPEWRDASVNHV
FLGDVAAWYVNDLAGINFDPAAPGFGHIIIAPHFVEALDWAAASYDSVRGEIRSEWRRRG
GCVTLKVTIPANTTADIRIDGETIATVAGGVHEFTF

Enzyme Prediction     

No EC number prediction in MGYG000001562_00329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	352	858	2.1e-159	0.9900793650793651
CBM67	143	326	3.2e-41	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.83e-103	464	788	1	335	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.05e-61	170	339	3	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.22e-33	353	460	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.34e-19	795	870	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10137	PRK10137	0.008	631	676	583	630	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23306.1	0.0	20	876	19	878
QDM10804.1	0.0	14	876	11	878
QUT32044.1	0.0	14	876	11	878
CBK67657.1	0.0	14	876	11	878
QRM99258.1	0.0	14	876	11	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.31e-148	33	859	34	898	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.27e-118	37	875	12	1029	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.80e-89	30	874	3	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.36e-118	37	875	12	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	3.20e-113	41	857	42	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.88e-100	37	856	38	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	2.72e-94	37	859	42	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000842	0.162972	0.835908	0.000112	0.000075	0.000060

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_00329.