CAZyme Information: MGYG000001562_00517

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_00517
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		55680.68	8.1134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 409855; End: 411294 Strand: -

Full Sequence      

MNRLTLLAAAVLVAGSLAAKSPEYRRVEARENAQKPEWKSYEAKTVDRLPGFNCRKSDPK
QSVYGGWMVDRQEATGFFRTQKIGDRWWLIDPEGWPFIHKAVAVFTTGGSDRQKKALEEK
FGTRAAWAADQQEMLRRYGFNGLGAWSDVNTVRESERPMPYTVIVNPMGMYHGQHRRHFG
GKYKQAGWQGYRFDLAMVFDPGFDAVIDRAVAPIAKYRDDKYLLGYFTDNELPWVNDALD
RHLTLLAHDEDAYIAVRKWYDERKGVKDAPAAEITDADRKAFQAFYFDTYMRKVTEALRR
YDSNHLYLGCRFNQHRQEMASPEIFAVAGKYMDVISINHYRLWEPNAAWMADWEKWSGKP
FIITEFYTKGEDSGLPNNTGAGWNVRTQADRGWFYQNFVTELLRSGNCVGWHWFTYMDND
PQNLKTDPSNRDSNKGVVAWNFEPYTVLLDEMKQLNDCTFRLIRHLDAEKAEENRKTTK

Enzyme Prediction     

No EC number prediction in MGYG000001562_00517.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	114	457	7e-83	0.5482388973966309

CDD Domains     

MGYG000001562_00517 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ05111.1	4.26e-220	24	467	27	469
AWK02836.1	6.26e-220	24	467	28	470
AOC95464.1	4.17e-218	24	467	28	470
QGK72810.1	5.31e-218	18	467	19	467
QDW22820.1	8.73e-217	18	467	19	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	1.61e-60	31	467	46	480	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	6.31e-25	56	456	239	739	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.51e-24	56	456	239	739	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	1.57e-22	61	460	263	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	8.82e-22	56	460	258	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	7.43e-23	42	462	452	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	6.46e-15	127	456	557	909	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000331	0.998897	0.000175	0.000195	0.000189	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_00517.