CAZyme Information: MGYG000001562_00526

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_00526
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	MGYG000001562_11|CGC8	50600.29	5.4021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 426921; End: 428270 Strand: +

Full Sequence      

MKRTILTAALAACTLAAAAQEERNPVPMTSHGGRIYRTEVVPYDARHDADARNREAGGYW
KVFSPEVTVTTEGPLYAILGQEIDIPFAWTDGVVCLHLENPGSAYSLWLNDRQVADVSDP
LTPAEFDLTPYVREGVNNFKLLMRNDNPARQLDAAVPADRKPFENSYLYYQNKRSIADFE
IGLVPDTLGRDFGMLDLRIVAQNAFNYDEPVTVGYDIYSPQGKLLEFNMTEVTIPGRSTD
TVRFSPFIYHTYDNKWEAGSKTPPLYKVMLFTRRNGVYKEYMPMKIGFGKTELIDGRVMR
LGKELKLEKAGYNAAADRKTALAELKALKAKGKNTICPDYPQPAWFYELCDELGLYVIDQ
ANINAPERSGDRTVGGTPSNDPKLAEEYLERVKAMYYRSRNFTCVIAYSLGGPSGNGYNM
YKAYQWLKSVEKSRPVIYADADGEWNTDL

Enzyme Prediction     

No EC number prediction in MGYG000001562_00526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	82	441	1e-38	0.4175531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	3.00e-31	91	438	145	487	beta-galactosidase.
COG3250	LacZ	2.12e-24	44	438	41	431	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.17e-21	85	444	119	481	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.96e-17	315	438	32	160	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	5.34e-06	82	137	72	127	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL07145.1	1.08e-234	1	449	1	445
BBL00145.1	1.75e-228	1	449	1	453
BBL11042.1	5.01e-228	1	449	1	453
BBL08251.1	5.01e-228	1	449	1	453
AFL78621.1	4.35e-224	1	449	1	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	2.44e-29	85	449	132	496	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.93e-28	85	449	136	500	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SD0_A	6.48e-28	28	438	82	466	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	6.48e-28	28	438	81	465	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
3DYM_A	4.93e-27	69	438	114	486	ChainA, Beta-galactosidase [Escherichia coli K-12],3DYM_B Chain B, Beta-galactosidase [Escherichia coli K-12],3DYM_C Chain C, Beta-galactosidase [Escherichia coli K-12],3DYM_D Chain D, Beta-galactosidase [Escherichia coli K-12],3E1F_1 Chain 1, Beta-galactosidase [Escherichia coli K-12],3E1F_2 Chain 2, Beta-galactosidase [Escherichia coli K-12],3E1F_3 Chain 3, Beta-galactosidase [Escherichia coli K-12],3E1F_4 Chain 4, Beta-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5F5U6	1.06e-27	25	438	83	484	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
Q04F24	1.43e-27	102	438	143	482	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
Q56307	3.55e-27	28	438	82	466	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q48727	8.23e-27	84	442	116	460	Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=lacZ PE=3 SV=3
B5XQY2	1.51e-26	25	438	92	494	Beta-galactosidase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002636	0.947986	0.047493	0.000940	0.000494	0.000427

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_00526.