CAZyme Information: MGYG000001562_00637

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_00637
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000001562_12|CGC1	40753.57	5.2472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 17082; End: 18161 Strand: -

Full Sequence      

MAVLSAACSESSPFPVDSRATPETCALYRNLFRVVDDGVMFGHQDDALYGHGWKYEEGRS
DVKECCGDYPAVFGWELGGLEAGADRSIDDVPFAEITRLLCAAYGRGAVNTVSWHPQNPE
SGANAWDCKTSTAVKSILPGGANHAEFRLWLDRLAGFFAGLKAADGTLAPVLFRPFHEHT
GSGFWWGEAQCTPDEYRALWRFTVEYLRDVKGVHNLLYVYSPDLYRDAEHYMERYPGDEW
VDVLGLDAYHRQQDWDFLSGGERMLSTLQQLGREHGKPTAFTETGLEGIPDAEWWTRWLL
PVIRGKGLSYVLVWRNAHDRPTHFFGPWHGHVSEPDFRKFAVNREQPVLFESRLPDMYH

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	16	298	5.4e-61	0.8382838283828383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.51e-36	16	249	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	9.00e-19	169	324	180	316	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL03722.1	2.49e-262	2	359	10	367
BBL15912.1	7.14e-262	2	359	10	367
AIA99594.1	1.09e-127	9	341	17	355
AWM31551.1	9.41e-126	2	354	14	365
ACY47369.1	9.01e-125	6	358	17	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	6.85e-119	21	350	9	335	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	2.62e-92	13	358	31	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	2.62e-92	13	358	31	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	5.22e-92	13	358	54	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.09e-91	13	358	31	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	4.93e-60	16	317	50	363	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	5.97e-50	17	341	44	387	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P55278	2.42e-21	41	288	61	295	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
O05512	1.61e-20	62	285	79	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P16699	5.99e-20	104	285	121	297	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000029	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_00637.