CAZyme Information: MGYG000001562_00707

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_00707
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000001562_12|CGC2	42476.48	8.3942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 108494; End: 109651 Strand: +

Full Sequence      

MLLGMTLAAEAAAASTAAGESGRSVRNSASAAPVVGEAVTVFTEGEAGYAGFRIPVVIRT
DDGALIAFAEARRHDKRDSGDIDLVMRRSEDDGRTWGPITTVWDDGGNTCGNPAPAVLGG
GRIVMLATWNRGCDRERQIENRTSVDTRRVFVLRSEDHGRTWSRPEEITSGVKDPGWTWY
ATGPCHAIVKRRAPHKGRIVVPANHKRLENDGRVESYSQLLFSDDEGRTWQLGAVSQRGG
NESTVAELADGSLLLNMRHYERGDSLRLYAVSRDGGTSWSIRGEHPELVEPRCQGSLLNL
TRGGRPTRRLLFCNPHDPRRRHNLSLCESRDNGRTWHHLATVCPGPSAYSDLVRLGRNRV
GVLYENGDADDLYRRISFTVITLRP

Enzyme Prediction     

No EC number prediction in MGYG000001562_00707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	39	379	1.2e-89	0.9678362573099415

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	6.39e-99	39	382	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.52e-33	63	362	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	6.82e-07	61	365	376	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd00260	Sialidase	9.90e-06	52	184	15	143	sialidases/neuraminidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed beta-propeller fold. This hierarchy includes eubacterial, eukaryotic, and viral sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD46002.1	5.62e-106	41	381	39	370
QDV16491.1	3.13e-102	40	384	40	379
QDT26944.1	6.26e-102	40	384	40	379
QDU50208.1	6.26e-102	40	384	40	379
QDT20890.1	2.51e-101	40	384	40	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	5.06e-37	45	377	174	516	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
7P1B_C	6.74e-36	48	371	58	384	ChainC, Sialidase domain-containing protein [Aspergillus terreus NIH2624],7P1D_A Chain A, Sialidase domain-containing protein [Aspergillus terreus NIH2624],7P1E_A Chain A, Sialidase domain-containing protein [Aspergillus terreus NIH2624],7P1F_A Chain A, Sialidase domain-containing protein [Aspergillus terreus NIH2624],7P1F_B Chain B, Sialidase domain-containing protein [Aspergillus terreus NIH2624],7P1O_A Chain A, Sialidase domain-containing protein [Aspergillus terreus NIH2624],7P1O_X Chain X, Sialidase domain-containing protein [Aspergillus terreus NIH2624]
6MNJ_A	1.62e-35	52	381	200	537	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
6MYV_A	1.18e-34	45	384	174	518	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	1.53e-34	45	384	195	539	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O35657	4.40e-31	52	367	71	390	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
A5PF10	4.88e-31	52	367	78	397	Sialidase-1 OS=Sus scrofa OX=9823 GN=NEU1 PE=3 SV=1
Q4WQS0	1.52e-30	48	384	54	393	Exo-alpha-sialidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G13800 PE=1 SV=2
A6BMK7	1.74e-30	52	367	77	396	Sialidase-1 OS=Bos taurus OX=9913 GN=NEU1 PE=2 SV=2
Q99PW3	2.20e-30	52	367	71	390	Sialidase-1 OS=Rattus norvegicus OX=10116 GN=Neu1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.826329	0.173256	0.000107	0.000136	0.000091	0.000097

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_00707.