CAZyme Information: MGYG000001562_01474

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_01474
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		29991.31	7.4789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 258707; End: 259486 Strand: -

Full Sequence      

MIPKKIHFCWLGGGKYPERVRQCMESWRRALPGYEIVRWDESRFDVNSVPWVREAIERKK
YAFAADYIRHYALYHEGGIYLDTDVEVLKPFDDLLDAEMFAVIETEESVLARNIAQDRIS
EAGEVLTDELFADVGLGLQSGAFGVTARHPFTRRCLDWYESHRFIREDGTLYDRIIAPDI
MAYHARPAGLKYKDVAQELDEGIRIHPSPTIAAYAAKAVPESYAIHHCLGSWRPAAPCRK
KKWYSRWWKSLMRGLGLHK

Enzyme Prediction     

No EC number prediction in MGYG000001562_01474.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	18	96	1.7e-23	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	4.84e-23	1	98	81	181	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.14e-21	17	101	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.94e-08	1	100	45	150	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	8.83e-07	40	122	139	225	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.001	4	84	1	91	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK68805.1	1.99e-65	1	246	1	245
QUR43722.1	1.99e-65	1	246	1	245
QRM97945.1	1.99e-65	1	246	1	245
QUT47110.1	2.34e-65	2	246	3	245
AII62444.1	1.03e-64	1	253	1	252

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14084	1.36e-07	2	172	64	214	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q5ZU30	2.04e-07	2	93	28	145	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1
Q10323	1.60e-06	2	114	57	171	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_01474.