CAZyme Information: MGYG000001562_02024

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_02024
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	MGYG000001562_16|CGC3	97558.72	6.278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 288206; End: 290743 Strand: -

Full Sequence      

MYLCMALAAAASPVRQRLHDDWQFRQARLNNWYPATVPGTVHTDLMANRIIEDPYFRLNE
RGVQWVDKEDWIYETHFEAGADLLARERIELVFEGLDTYADVYLNDEKILTTDNMFRRWR
TEVKRLLRPGENALKVYFHSPIKVDLPKYDSLPYRYEAINDQSANGGLFDKRVSVFARKA
GYHYGWDWGPRLVTSGIWRPVYLEGWNGIRISDVFYRQEEVTAERARVQVEVEIDAVREQ
PRAVVTVTAPGEGIEASVTTPLRPGVNRVTVPLDIASPKRWWTRELGEPHLYEFRTSVAA
GDVSDSRTTRIGLRSLRLVREKVSDGTTFRFELNGEPLFAKGANYIPCDVFLPRVTRAVY
EKTIDDAAAVNMNMLRVWGGGVYEDDVFYELCDERGILVWQDFMFACSIYPAEGAWLENV
RLEAEDNIRRLRNHPSIAVWCGNNECNDAWFGWGWNARYTKQGHPEYDKIIDTQFKRQYY
EVLPEAVAAFSPGTPYHPSSPWSCYEGTSENSEGDTHFWKVWHSRAPIADYNTTRSRFFS
EYGFQSFPEYASVLCFAPEERDWDIESEVMMAHQRGGSFANMRIRQYLEDEYWPARDFRT
FLYMSHVLQGDAIKTAIEAHRRDKPYCWGSLFWQHNDCWPVASWASRDWYGRWKAQHYFA
RPAFDDLLVSPCTANGRLEVFLVSDRRETVRGKLETTVLKMDGTVLSKNSRRVTLGPNAV
RKVHSADISGLLHGCSPGEAIVVTQFTTGGRRYSNIGYFAPQKELALPEADIRWSAEPTA
EGYAVTLTSDRFVRAAWLSLDGNEHFEDNYFDLLPGVGRTVGVSTKLSRDKFDRLLRITH
LQQTR

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	10	722	6.1e-109	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.29e-110	12	820	9	781	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	1.30e-15	676	764	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	2.89e-15	769	841	1	76	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.02e-13	209	314	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	3.08e-12	24	462	63	465	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63191.1	0.0	5	845	1	841
QDO68488.1	0.0	3	841	19	861
ALJ60279.1	0.0	3	841	19	861
QUT88714.1	0.0	3	841	19	861
QUT74423.1	0.0	3	841	19	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	4.37e-227	18	844	11	837	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.66e-227	18	844	13	839	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.81e-227	18	844	13	839	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.28e-226	18	844	11	837	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	5.58e-225	18	844	11	837	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	8.63e-123	18	824	9	839	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
B8NW36	9.23e-123	18	824	9	828	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	2.53e-122	18	824	9	828	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
A2QYN2	1.91e-121	11	824	2	829	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q4WAH4	3.83e-121	18	823	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.922862	0.076496	0.000258	0.000145	0.000088	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_02024.