CAZyme Information: MGYG000001562_02189

Basic Information

• Species: Alistipes timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes timonensis
• CAZyme ID: MGYG000001562_02189
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		68112.67	6.8399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001562	3488594	Isolate	not provided	not provided

• Gene Location: Start: 148049; End: 149872 Strand: -

Full Sequence      

MKSKIVLSVLLLWTAVAVRGQHFDYDAIAPHPRLLLPSVDEAAVKAAAEQVPALAWIQSR
LFAFCDATLSEPPVERIKTGRRLLDVSRLALKRIYYLAYAYRMSGDERYYAGAVREMEAV
CTFEDWNPIHFLDVGEMVLGLAIGYDWLYDRLPGEMRARICRAIVEKGFAPTAIPKYGDK
CYKRTNNWNQVCNAGLVYGALAIYEEFPEQCREIVEKCMESNPRAMTVYAPDGGYPEGYN
YWGYGTGFEVMLIAALESALGHDGGLSASEGFLASARFMQFMTGPCGYSFNFSDAPPRAF
VQVMFPWFARRTGDCSLLWNYLPGGEGPQTDFTDHRLLPTLLLYAAGVDWSSVREPARHT
WFNRGKTPVYIYRSGWNSPDDLYLGVKGGSAATSHAHMDAGSFVFDALGERWAMDLGMQN
YYSLESRGIDLWSKKPESKRWEVFRIGNSSHNTLTINGCHHQIRGFAPIVDTIGSHGSHG
AVIDLTEVLGEGLRCAQRTVTVERDRYLFVCDRIETGDMPVRVEWTMCTPAQAVVTGRNR
IELTQNGKRMTLVADAPGCRVRMRVLSNDPPNDWDAPNPGTVHVGFETEIPAGQRRELRV
RLIPRNL

Enzyme Prediction     

No EC number prediction in MGYG000001562_02189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	380	555	1.1e-61	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	1.71e-06	385	558	29	194	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16332	DUF4962	1.07e-04	29	241	135	362	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40059.1	9.32e-237	1	604	1	602
CBK67360.1	5.34e-236	1	604	1	602
QUT26392.1	5.34e-236	1	604	1	602
QGT72630.1	5.34e-236	1	604	1	602
QRQ54739.1	7.57e-236	1	604	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	5.43e-11	137	607	259	739	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	4.94e-10	137	607	259	739	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000204	0.999217	0.000140	0.000154	0.000138	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001562_02189.