CAZyme Information: MGYG000001564_00127

Basic Information

• Species: Enterocloster clostridioformis_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster clostridioformis_A
• CAZyme ID: MGYG000001564_00127
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000001564_1|CGC5	45484.68	4.6399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001564	4026190	MAG	United States	North America

• Gene Location: Start: 143738; End: 144919 Strand: -

Full Sequence      

MNIKGVNLGNWLVLEKWMSPALFEGTGAQDEYYLPRWLSREVYEARIRIHRSEYITERDF
AAIRAMGMEAVRIPVPYFIFGDREPFIGCVEELDKAFCWAERYGLKILIDLHTVPEGQNG
FDNGGICGVCRWSKNPAEVEFVLGVLERLAKRYGERAGLWGIEVLNEPITERMWKIIDVP
GRYPAAEPSMAEGSGPNSMEFLREFYLKAYDCLRKHMPEEKYVVIHDGFELKAWKDFMRE
DRYVNVVLDTHQYLMFAETEGCGQTLPDYLEYIRRHFAKGIEEMQQYFDVICGEWCLFNS
LACGCDTKGGRSVLNGEEGAGQDVMDEKEKAHIYRALAEAQTEAWGKGSGYFYWSYKLLT
DTVNEDGWIGWDSWDFGRCAAFGWFPVDKEELR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	357	5e-138	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	7.02e-21	2	379	17	381	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	0.006	53	168	22	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU19071.1	4.96e-291	1	393	1	393
QQR01615.1	1.14e-276	1	393	1	393
ARE65151.1	1.14e-276	1	393	1	393
QRT49144.1	1.40e-234	1	386	1	386
QMW78416.1	4.11e-232	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	6.53e-179	1	386	1	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	5.33e-178	1	386	1	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	2.85e-43	3	386	13	391	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	1.18e-39	3	386	9	379	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	3.17e-39	3	386	9	379	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	1.67e-48	3	390	31	400	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	1.67e-48	3	390	31	400	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q5B5X8	6.67e-47	3	390	29	398	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
O93983	2.07e-46	3	386	42	414	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
Q12628	1.14e-45	3	386	36	413	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001564_00127.