CAZyme Information: MGYG000001564_00830

Basic Information

• Species: Enterocloster clostridioformis_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster clostridioformis_A
• CAZyme ID: MGYG000001564_00830
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000001564_7|CGC2	52560.02	4.7539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001564	4026190	MAG	United States	North America

• Gene Location: Start: 79515; End: 80915 Strand: +

Full Sequence      

MKYSDNKVKDIQIAYIGGGSRGWAWTFMTDLALEDQISGTIRLYDIDGDAAKNNEVIGNR
LMQRDDAKGDWKFETSLSLKDALTGCDFVVISILPGTFDEMESDVHLPERLGIYQSVGDT
AGPGGMVRALRTIPMFVEIAEAIKEYAPKVWVINYTNPMSLCVKTLYQVFPEIKAFGCCH
EVFGTQKVLKGICEESCGEKEIDWHDIHVNVLGINHFTWFSSASYKGIDLFPVYQDYIDA
HFDQGYEVEGENWMNSSFKCANRVKMDLFKRYGLIAAAGDRHLAEFMPGNEYLNDPETVA
SWKFGLTTVQWRKNDLKERLERSRRLAAGEEEVKLDPTGEEGILLIKALCGLTRVVSNVN
IPNTACQITNLPADALVETNAVFEKDHIYPVVAGAVPENVKELLMPHLENHELIMEAALH
PDKEKVVRAFMNDPLVKGKNCREEDVRLLVDDMIKNTLTYLPKGWE

Enzyme Prediction     

No EC number prediction in MGYG000001564_00830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	13	190	3.4e-56	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.56e-163	11	454	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.55e-103	9	463	2	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	5.43e-70	12	462	3	428	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	4.93e-57	12	189	1	177	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	6.81e-49	11	454	1	423	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU19660.1	0.0	1	466	1	466
QIX89596.1	0.0	1	466	1	466
ANU44839.1	0.0	1	466	1	466
QQR00399.1	0.0	1	466	1	466
QRP39116.1	2.11e-274	1	466	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.03e-154	11	437	6	422	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1OBB_A	7.69e-27	11	454	4	465	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
1S6Y_A	3.80e-23	4	466	1	442	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
5C3M_A	9.11e-23	9	466	3	439	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
7BR4_A	2.49e-18	11	438	13	454	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	6.38e-249	1	466	1	465	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	3.65e-198	1	466	1	462	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	6.30e-184	1	465	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	8.34e-158	11	455	10	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P30877	6.57e-44	12	462	6	446	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001564_00830.