CAZyme Information: MGYG000001567_01619

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001567_01619
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000001567_23|CGC1	54163.28	5.4499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001567	2622247	MAG	United States	North America

• Gene Location: Start: 35584; End: 37038 Strand: +

Full Sequence      

MPFPDGFLWGGATAAAQVEGAWRASGKQPSIQDRVRGCAAGEKRMFNPVPHEDAYYPSHE
AVDFAGHVDEDLALMAEMGFTCYRMSIAWSRVFSDDECRVPNEEGLAFYDRIIDRCVAYG
MQPMVTINHFDMPLALACAHRGFVDRACIDAYRRFAELLLRRYRSRVRYWLPFNEINFGI
MPMGAFKAQGIVPRELAEADRWTPSSAIGATLPEQVQALHHQFVASAQVAALAHAIDPDN
RVGCMIGHITQYPLTCDPADVLACQENDRLLNKCCGDVLVRGTYPAYMRAWMEKRGVAPA
MEPGDEELLAAHTVDFYAFSYYMTNCIAARDAGERVDGNLMGGLKNPYLSASAWGWQVDP
QGLRYTIHQLSDRYSVPLMVVENGLGARDEVAQDGCIHDDYRIAYLRDHIAEMRRAVEEG
ADVMGYTAWSPIDSVSSSTGQMSKRYGMVYVDRHDDGSGTGERMRKDSFAWYRRCIRSNG
ADLA

Enzyme Prediction     

No EC number prediction in MGYG000001567_01619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	480	1.3e-136	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	1	482	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	3.63e-176	3	484	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	6.59e-169	1	483	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	1.58e-168	1	483	4	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.61e-167	1	483	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXJ61437.1	3.83e-189	1	484	1	472
QZO10741.1	7.71e-189	1	484	1	472
BBF44818.1	1.72e-188	1	480	1	474
BCZ48524.1	1.07e-184	3	483	2	476
BCN32466.1	6.33e-184	3	483	4	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.74e-152	1	483	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	8.14e-151	3	483	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	4.02e-138	4	483	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.14e-137	4	483	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	2.87e-137	3	483	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	9.54e-152	1	483	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	3.60e-149	3	483	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	3.32e-143	3	483	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	1.79e-141	4	483	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P11988	6.11e-140	3	483	4	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001567_01619.