CAZyme Information: MGYG000001570_00424

Basic Information

• Species: UBA4871 sp014467055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA4871; UBA4871 sp014467055
• CAZyme ID: MGYG000001570_00424
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224		24138.91	7.765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001570	1608657	MAG	United States	North America

• Gene Location: Start: 61; End: 735 Strand: +

Full Sequence      

MDNEAQPASAKAGITEAAIAFCETMEAAGYFVGIYGSAVSGFQERMDDSKLKAYSHWVAQ
YASKCTYSGEYGIWQYSSTGKVDGINGNVDMDYGYIDYPSIIKNGGFNGWSKGSAAATYT
KSVDELTAEVIRGDWGNGETRKQRLTAAGYDYAAVQAKVNEILSGKSASTTAAYETYTVV
KGDTLWGIASKKLGNGTRYKEIKTLNGLSSDTIYAGQKLKIPKK

Enzyme Prediction     

No EC number prediction in MGYG000001570_00424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	2	85	3.5e-16	0.4971751412429379

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.70e-36	1	95	94	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
pfam08230	CW_7	6.09e-19	124	163	1	40	CW_7 repeat. This domain was originally found in the C-terminal moiety of the Cpl-7 lysozyme encoded by the Streptococcus pneumoniae bacteriophage Cp-7. It is also found in the cell wall hydrolases of human and life-stock pathogens. CW_7 repeats make up a cell wall binding motif.
smart01095	Cpl-7	1.72e-16	123	163	1	41	Cpl-7 lysozyme C-terminal domain. This domain was originally found in the C-terminal moiety of the Cpl-7 lysozyme encoded by the Streptococcus pneumoniae bacteriophage Cp-7. It is assumed that these repeats represent cell wall binding motifs although no direct evidence has been obtained so far.
pfam01476	LysM	4.26e-16	177	222	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	2.63e-12	176	221	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1255334.1	8.65e-143	1	224	98	321
ARP51107.1	5.39e-91	1	206	97	301
QKN24292.1	8.98e-65	20	206	114	295
ARP50082.1	8.98e-65	20	206	114	295
ARP49658.1	7.51e-62	20	206	115	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CVD_A	6.21e-07	129	166	7	44	ChainA, LYSOZYME [Streptococcus phage CP-7]
5I8L_A	1.78e-06	121	166	6	51	ChainA, Lysozyme [Streptococcus phage CP-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	6.49e-08	110	221	20	129	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q5HRU2	4.26e-06	143	222	123	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	4.26e-06	143	222	123	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001570_00424.