CAZyme Information: MGYG000001570_01347

Basic Information

• Species: UBA4871 sp014467055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA4871; UBA4871 sp014467055
• CAZyme ID: MGYG000001570_01347
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		31142.21	4.8645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001570	1608657	MAG	United States	North America

• Gene Location: Start: 1232; End: 2065 Strand: -

Full Sequence      

MLKGAVETANRVTTVSPTYAKEILDPWYSHGLDGILKQREWKLSGILNGIDTESYNPETD
KDIFANYTAEDLSGKAENKRALQERLGLAQDAEVPLVGMVTRLVSHKGLDLVKEDLDHLM
QETNMQFVVLGSGDWEYEKFFQDMQNRYPGRLCACHGFVPELSRKIYAGADIFLMPSKSE
PCGLSQMIALRYGTIPIVRETGGLKDSIQDSGDGVGNGFTFHTYDSGDMDNAVRRALAGY
SDKEGWNILVERAMHCDMSWGKSANEYIRMYRDMLKE

Enzyme Prediction     

No EC number prediction in MGYG000001570_01347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	1	272	9e-113	0.576271186440678

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	3.46e-154	1	273	201	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.33e-151	1	276	190	465	glycogen synthase GlgA.
TIGR02095	glgA	1.05e-134	1	272	198	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	3.26e-125	1	272	201	476	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	7.97e-89	2	277	203	482	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18264.1	5.69e-203	1	277	198	474
ARP51332.1	1.90e-175	1	277	198	474
QKN23272.1	1.90e-175	1	277	198	474
QKO30046.1	1.90e-175	1	277	198	474
CAB1241630.1	3.05e-163	1	277	40	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.83e-68	2	271	198	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.22e-67	2	271	198	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	9.50e-67	2	271	198	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.46e-63	2	271	216	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	7.02e-58	2	271	348	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6TSC8	5.04e-90	2	274	201	474	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
Q72YJ6	9.26e-88	2	276	201	476	Glycogen synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=glgA PE=3 SV=1
A4IS20	2.65e-86	2	277	201	477	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
B9J2G5	8.26e-86	2	276	201	476	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1
O08328	1.05e-85	2	277	201	477	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001570_01347.