CAZyme Information: MGYG000001570_01472

Basic Information

• Species: UBA4871 sp014467055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA4871; UBA4871 sp014467055
• CAZyme ID: MGYG000001570_01472
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218		24741.52	9.619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001570	1608657	MAG	United States	North America

• Gene Location: Start: 1108; End: 1764 Strand: -

Full Sequence      

MSRVSDSARTKVHRMIAIRNRTLIVMAVVVIFALIAYVCTLSMQKSSQQLEYASYPRTYS
EYVELEAKEFHVEPALVYAVIKQESGFDPKCVSQAGAVGLMQIMPDTFSWMLSTMDKSDK
KQYTTDDLYDPKVNIRFGCKYLATLEKLFPNQSTTLAAYNAGMGNVSGWLKNKNYSADGK
TLKQIPFSETRAYAKKVMDNYAQYKKLYYTHNASSVTK

Enzyme Prediction     

No EC number prediction in MGYG000001570_01472.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	60	206	4.2e-34	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.20e-70	56	201	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.70e-54	55	207	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.09e-43	74	202	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	9.20e-38	15	216	92	295	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	5.72e-31	61	201	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO16977.1	8.39e-152	1	218	1	218
QKN24320.1	1.75e-73	1	217	3	221
QKO30667.1	1.75e-73	1	217	3	221
ARP49959.1	1.75e-73	1	217	3	221
CAB1246558.1	1.78e-56	19	208	14	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.45e-18	42	208	398	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.46e-18	42	208	408	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O1J_A	1.46e-18	42	208	402	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.47e-18	42	208	412	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.47e-18	42	208	418	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	4.16e-22	54	203	1417	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.16e-22	54	203	1417	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O31608	4.11e-17	67	201	68	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC3	2.37e-16	55	205	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.37e-16	55	205	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000020	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
21	43