CAZyme Information: MGYG000001571_01395

Basic Information

• Species: Lacrimispora sp000526575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp000526575
• CAZyme ID: MGYG000001571_01395
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001571_9|CGC1	42063.57	4.8001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001571	4730558	MAG	United States	North America

• Gene Location: Start: 36410; End: 37528 Strand: +

Full Sequence      

MSNEQLLEKIHLVVEKLMNLGGSDYDKDQTVSSTDTSKGIIQRDFGIEEWDWPQGVGLYG
LKKLQDFYGDDRYLPFFDRWYHGHMERGLPSKNINTTAPFLPLSYISDKLSNSQDLKKLL
MERADWLMNELPKTPDNGFQHVTSAIGDRNGVNLNEGQIWVDTLFMSVLFLNHMGHQEHK
KEWKEEATHQFLVHIKYLFDKGTGLFHHGFRFDQMDNFGGIFWCRGNSWFTYGIMEFLDD
CGEEMSQGVRDFFIDTFKAQANAMLRLQAPSGLWYTVLTDETSYEEVSGSAAIAAGLLRG
VKAGILDDTYKKAADKAIEAICNNISEDGTVLNVSAGTGIGMDADHYKNILLMPMAYGQA
LALTALCEALEK

Enzyme Prediction     

No EC number prediction in MGYG000001571_01395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	370	1.3e-89	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.42e-85	49	370	33	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.65e-80	49	370	26	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU08132.1	5.34e-223	1	372	1	372
AIQ28570.1	9.28e-191	1	371	1	371
AIQ40335.1	1.78e-188	1	371	1	371
QUL56643.1	2.05e-188	1	371	1	371
AIQ71725.1	2.52e-188	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.77e-71	2	371	22	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.63e-70	46	372	62	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	4.63e-66	46	368	43	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	3.02e-18	48	331	21	311	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.14e-44	25	371	6	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001571_01395.