CAZyme Information: MGYG000001571_01397

Basic Information

• Species: Lacrimispora sp000526575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp000526575
• CAZyme ID: MGYG000001571_01397
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000001571_9|CGC1	52249.53	4.9322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001571	4730558	MAG	United States	North America

• Gene Location: Start: 38574; End: 39971 Strand: +

Full Sequence      

MNYSDNKITDLKIAYIGGGSRGWAWTFMTDLSMDDSLSGTIRLYDIDESASKNNEIIGNQ
LSAREDTIGKWKYETSSSLKDALTGCDFAVISILPGTFDEMASDVHLPERLGIYQSVGDT
AGPGGMIRALRTIPMFVTIAEAIKEYAPKAWVINYTNPMSLCVKTLYHVFPEIKAFGCCH
EVFGTQKVLKGICEEFLGLKDVERKDIHVNVLGINHFTWFDQASYKGIDLFPVYCDYIDS
HYEEGYNEPDKNWANSTFECAHRLKFDLFRRYGLIAAAGDRHLAEFMPGDEYLKNPETTK
SWKFNLTTVAWRKEDLKTRLEKSHRLVTGEEKIELKPSGEEGILLIKSLCGLERTISNVN
IPNTYLQIPNLPADAIVETNAAFDRDSIKPIVAGAIPVNVLELIKPHVDNHERILNAALT
CDRSLVYDAFLADPLVKGRATEEEIKTLADDMIANTMAYLPDGWK

Enzyme Prediction     

No EC number prediction in MGYG000001571_01397.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	190	9.3e-55	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.40e-167	11	453	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	8.05e-106	11	461	4	437	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.16e-72	12	462	3	429	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	9.33e-57	12	189	1	177	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	9.11e-50	11	454	1	424	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU08117.1	3.90e-304	1	465	1	465
QOV18776.1	1.05e-276	1	465	1	466
QOV18468.1	2.25e-271	1	465	1	466
BCJ94352.1	3.44e-271	1	464	1	464
ABX43208.1	3.13e-267	1	465	23	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.38e-158	7	437	2	422	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	1.62e-27	11	465	5	439	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	7.76e-27	4	465	1	442	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
3U95_A	7.33e-20	11	454	1	456	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]
7BR4_A	2.41e-19	11	452	13	465	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	9.61e-260	1	464	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	9.78e-203	1	465	1	462	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	9.32e-181	1	464	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.86e-161	6	453	5	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P30877	8.84e-49	8	461	2	446	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001571_01397.