CAZyme Information: MGYG000001571_03049

Basic Information

• Species: Lacrimispora sp000526575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp000526575
• CAZyme ID: MGYG000001571_03049
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001571_26|CGC1	43184.09	4.6997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001571	4730558	MAG	United States	North America

• Gene Location: Start: 34585; End: 35706 Strand: +

Full Sequence      

MYINELMEKSTPDCPAWNIEKLLSGEKSGWNYIDGCMIKAILEMYAITKNSRYFEFADAF
IDHRVREDGTIDGYDVEELNIDNINAGKTLFELYDLTGKEKYRKAIDLIYSQIGMMPRTK
EGNFWHKNIYPNQVWLDGLYMCQPFYMEYETRFHDKKNCNDIYSQFSNVKQFMKDTETGL
YYHAYDSEREMFWCDKVTGLSQNFWLRALGWYSMALLDTMDKADPQDTQEVNGMKEAFVS
LIDAMLKYQDESGMWYQVVNLGGMDKNYLETSGSAIFSYAILKGVRLGYLPADYAQYGKK
AFLGICDKYLNLEKGNMSLGGICLVAGLGGKDRRNGTFDYYMSEPIVKDDAKGVGPFLLA
YTEMKRTGWEYQS

Enzyme Prediction     

No EC number prediction in MGYG000001571_03049.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	26	366	5.3e-113	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.36e-96	18	367	22	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.42e-81	29	367	26	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET55199.1	5.22e-243	2	371	7	376
CBL12002.1	1.40e-221	2	366	7	372
CBL09353.1	4.02e-221	2	366	7	372
VCV21981.1	2.32e-220	2	366	7	372
AEN96572.1	7.07e-218	2	368	7	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	7.66e-106	30	363	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	8.99e-70	16	365	27	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.78e-69	16	365	17	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	1.23e-13	28	366	64	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.71e-12	28	305	63	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.92e-69	16	365	27	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.51e-41	144	363	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.51e-41	144	363	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001571_03049.