CAZyme Information: MGYG000001571_03679

Basic Information

• Species: Lacrimispora sp000526575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp000526575
• CAZyme ID: MGYG000001571_03679
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36331.67	4.6317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001571	4730558	MAG	United States	North America

• Gene Location: Start: 22823; End: 23788 Strand: -

Full Sequence      

MIHIAQDGSGDFKSIMEALNSLPKDNSSEQILFIHKGFYEEQITVTIPHVTFQGEDADTT
ILSYGLYAKMMMDDGMKRGTFRTYSCLIDTHDFTAKNITFENSAGIGTEVGQALALYADG
DRLVFENCRLLGNQDTLFTGPLPPKEIEVNGFIGPKQHAPRINGRHYYKDCYIEGDVDFI
FGSATAYFEGCTFFSKYTGKEISSYVTAASTPEGQEYGYVMTDCRFESNCPPNNAYLGRP
WREYAKTVLINCFMDDHICKEGWDDWNKEAAHEHAFYAEYGSYGPGAVMEQRPDWIFHLS
KEELIKYTKDAVLCGADNWRP

Enzyme Prediction     

No EC number prediction in MGYG000001571_03679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	313	1.5e-94	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.01e-86	1	315	83	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.64e-72	4	308	4	290	Pectinesterase.
PLN02773	PLN02773	9.84e-65	1	303	6	286	pectinesterase
PLN02990	PLN02990	3.66e-61	4	321	263	561	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	2.79e-60	1	319	12	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	9.48e-214	1	321	1	321
QRP39805.1	8.35e-141	4	321	20	349
ASN95501.1	8.35e-141	4	321	20	349
ANU50094.1	5.36e-139	4	321	19	348
QQR01004.1	5.36e-139	4	321	19	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	3.18e-36	12	321	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	2.04e-35	4	295	11	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.73e-35	4	295	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	9.96e-33	11	312	43	357	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	1.56e-25	10	292	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.90e-53	1	303	6	286	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	3.23e-52	4	321	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8GX86	6.57e-49	2	321	256	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q3E8Z8	2.29e-48	2	321	253	552	Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana OX=3702 GN=PME28 PE=2 SV=1
Q43043	4.82e-48	4	319	61	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001571_03679.