CAZyme Information: MGYG000001571_03940

Basic Information

• Species: Lacrimispora sp000526575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp000526575
• CAZyme ID: MGYG000001571_03940
• CAZy Family: CBM16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		80578.7	6.2975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001571	4730558	MAG	United States	North America

• Gene Location: Start: 10882; End: 13122 Strand: +

Full Sequence      

MNKKKGGMYLVVILLIHLFVFNWYGETAKAASVYYVSTTGNDKTGAGTVSNPWKTIQKAA
DIMEAGDTCIIRGGTYRETVTLDTSGTSANPIAFKAYTGETVTVSGADSVTDWVKHSGSI
YYATMTDSLGTKNQIFVNKQMQLEARWPNSATLDPLNSTLAAVDSGSATTINDGDLIQAA
GYWVGKTVWCVPGTGYKSYKSTITSSNAGSITFDKMDIAAKAGNSYYIIGDLKDLDSSGE
WYYDNGTSRLYLWAPGGVNPNTLTVEAKKRTYAFDLSSCSYINITGINIFASSIKMSASN
YCKVSDMTAEYISHDSDVSNQYSTGIFMSGTNNELRNSTLTYSSGNLISIQGTGNKVINN
LMHEADYSAADMPAIYLLGANHLISHNTVYNAGRHLIFMPTQNSRIQYNNLYNAGKLTND
CGIIYEFGWDGNGTVIDHNFVHDNLAKNYSGTGIYLDNGSKGYIVHHNVVWGNYTGIRLN
TPSNFNMIYNNTTYGNGNIGYWGSDFQTDMYGDRIFNNIFTTAFTLPGTHIEKNNITSGN
NPLFVNPTAHDFRLQAASPAINAGAVIPGITNGYVGSAPDIGAYEYGGTDWTAGHNFASP
PAPVFENVSVLYDNKVRQSDFEKGIISPWITTHSRTAASVSISRSCSKSVRLGTGEDGIK
QVLTGLKPATSYICTAWVKADPGEQIQIGVSGFGGTDVSATSASTTWTMVSIPFKTGTGA
TSATVYAYKMPGTSYVYVDDFGVVEH

Enzyme Prediction     

No EC number prediction in MGYG000001571_03940.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM16	616	728	4.9e-16	0.9655172413793104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	7.99e-11	324	492	1	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	2.95e-08	322	498	18	177	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam05048	NosD	6.06e-05	342	520	16	172	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam02018	CBM_4_9	2.01e-04	614	726	2	127	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO07777.1	0.0	1	745	1	745
AJE52964.1	0.0	1	745	1	745
QOH63199.1	0.0	1	745	1	745
AWB43436.1	0.0	1	745	1	745
AZH30628.1	0.0	1	745	1	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	2.69e-10	34	128	3	97	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	2.03e-16	585	741	260	417	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P94576	1.27e-07	35	106	37	107	Uncharacterized protein YwoF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywoF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000463	0.998819	0.000173	0.000194	0.000163	0.000164

TMHMM  Annotations     

start	end
7	24