CAZyme Information: MGYG000001571_04117

Basic Information

• Species: Lacrimispora sp000526575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp000526575
• CAZyme ID: MGYG000001571_04117
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1037	MGYG000001571_55|CGC1	119677.91	5.1955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001571	4730558	MAG	United States	North America

• Gene Location: Start: 7675; End: 10788 Strand: -

Full Sequence      

MKKINFVKYNKTRREAFQIRTSLVEEGGVPYVEKSALTPEGTAHIRSLGDKYKSLMEQNQ
RLKVAEVSVSPDGRTARFEFLKGETLSEILGREIKDGKVSVSKMEDAISMILSVKEDCML
PFHLTPEFKEVFGDLSQADEKIKKDWTFQASNIDCLFENIMLTENGPYCLDYEWVFTFPV
PVNFIKFRVLYYFYEQYKSILTYDSMEAFLEEFGVDGDRLSLYQEMERSFQEYVHGENQQ
IYLVNYMHETHAIPDDMFEVSQIIDDTKEQISQMEMELHEKDVTITKQQEVKRLTDNHVT
NQDMIITTLRKDCENMEEIINRLRRHEALFYRVGRRLKRLFNEKFPEGTRKRKLLYYTKN
TLLHPINSIRLYTTEEGRNLIEGDMKIGEAYRKHGKLRFVKEGHPMVSIIIPVYNQIHYT
YACLASILEHTKDVVYEVIIADDVSTDATSELTKFTENLVICRNETNQGFLKNCNQAAKA
ARGKYVMFLNNDTQVTEGWLSSLVNLIESDSTIGMVGSKLVYPDGRLQEAGGILWSDGSG
WNYGRLDDPEKPEYNYVKDVDYISGAAILLSNELWKQIGGFDERFAPAYCEDSDLAFEVR
KAGLRVVYQPLSKVIHFEGISNGTDVNGTGLKRYQVENSRKLQEKWAEEFKKQCENDGNP
DPFRARERSQNKDIILVVDHYVPTYDRDAGSKTTFQYLQMFVEKGYVVKFLGDNFLHEEP
YSTVLQQMGIEILYGPEYQAGIWNWLKDHSDDIKVAYLNRPHIAAKYIDFIKNKTNIKVI
YYGHDLHFLREGREYELTGDPEKRESSEYWKSMELRLMRKASVSYYPSYVEREAIHEIEP
SIHVKAIVAYVFETFLSRIPDDFSKREGLLFVGGFAHPPNIDAVLWFANDIFPLIRQVLP
VNFYIVGSKVTDEIKALEQPGNGIIVKGFVSDEELSRLYASCRVVVVPLRYGAGVKGKVI
EALYHGSPIVTTSIGAEGIPDAEKVMAVTDDPQGFAQEVVSMYQDTERCKQICEETQNYI
CRYHSIDAAWSVVGEDF

Enzyme Prediction     

No EC number prediction in MGYG000001571_04117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	408	533	1.2e-25	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	5.57e-49	409	618	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.96e-46	405	623	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13692	Glyco_trans_1_4	8.20e-26	869	1005	4	138	Glycosyl transferases group 1.
pfam00535	Glycos_transf_2	1.69e-24	408	528	1	124	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	7.51e-23	389	622	38	269	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL06321.1	0.0	1	1037	1	1037
QRV19580.1	0.0	1	1037	1	1037
SET96232.1	0.0	1	1037	1	1034
ASN93838.1	0.0	6	1037	268	1313
QRP41495.1	0.0	6	1037	268	1313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XHB_A	2.51e-07	396	651	20	291	TheCrystal Structure of UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase-T1 [Mus musculus]
5HEA_A	9.59e-07	406	515	6	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.81e-19	402	623	622	852	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.99e-18	396	625	565	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q8MYY6	4.43e-11	407	651	112	381	Putative polypeptide N-acetylgalactosaminyltransferase 13 OS=Drosophila melanogaster OX=7227 GN=pgant13 PE=2 SV=2
Q48455	7.37e-10	869	1020	213	371	Uncharacterized 44.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
P9WLV9	1.11e-08	400	546	12	148	Uncharacterized protein Rv1518 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1518 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001571_04117.