CAZyme Information: MGYG000001572_00359

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R
• CAZyme ID: MGYG000001572_00359
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		91206.47	5.6191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001572	1887218	MAG	United States	North America

• Gene Location: Start: 378174; End: 380567 Strand: -

Full Sequence      

MNKIDLSGNWTMKNCTDGKEYSAVIPGSDVGNLIKNNAVKNPLISGDDDEGRRLGENDIE
FKRSFSLSEDDMKYTHIHFYAGGLDTLCTCYINGKKAFESKNAFIPADIEVKEFLTTGEN
SICLHFDSSVKYITKLQKEKPLPKNCNGIDGIPYIRKPACHFGWDWGPCVPYCAVLDSIG
LKCFNRQIENIEIKQNTSSEKSVIKASADNADKITLISPDGDVISRDTDGLFTVENPSLW
YTYEMSQKEVQPLYTVVFENDEETVEKKIGLRSLYLDTSKDEYGSNFCFVLNGEKIFAKG
GNLIPFSAIYEDSDRGSVDYYLNLARKSNFNIIRIWGGGSYSDDYLISRCDEMGILVWQD
FCFACEMYPFYEEDFTKNVLDEVMVNVKRLTTHPSLALWCGNNELEVMFSYLPKNTKIMK
AYEEFFYHTLPDYIKDLTDVSYIPTSPIGSACFKEYSSDNVGDTHMWNVWHGLKKLDYYA
TRYSRFLSEFGLESLPSMKAIRTFAPPQEYDITSPSFNRHQKCVGGNKKMLFYLTEMFDF
PKRFEDLPYLTGIVQAECIKNATVHFRQNKGRCNGSIFWQFNDVWNCPSWSSVDFEGVPK
ALQYKAREFFAPITVSCRKEKGKAVIFAHNDTLSKASFKLTLKLFNPDMTKEYDVEIEPN
SFKRIDEIQVNKKSVLQLSFNGETLHEIFTSPVSLNLKKANIDAHLDGNKLTLKSDKFAY
NVFIDSDAIADENYFCLSAGEEKTVTFDKAPSSYSVTCANNIDFKKSCLSGIKKKLFRLF
YRLQPLNIANYFYYTYN

Enzyme Prediction     

No EC number prediction in MGYG000001572_00359.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	751	2.1e-70	0.773936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.13e-65	3	612	12	631	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	1.03e-07	699	747	5	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	2.56e-04	213	404	216	417	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	8.08e-04	188	272	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG59052.1	1.77e-150	4	749	3	793
BCJ98156.1	2.79e-148	1	789	1	848
QNF27003.1	2.46e-142	1	749	1	795
QNK42494.1	4.19e-141	4	749	3	796
ADZ84812.1	7.85e-141	1	757	1	805

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	8.77e-103	1	745	3	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	8.95e-103	1	745	3	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.16e-102	1	745	1	828	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	6.29e-102	1	745	3	830	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
5N6U_A	7.34e-102	1	661	24	708	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	3.53e-73	83	652	88	715	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q2TXB7	1.07e-72	6	620	9	663	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	1.07e-72	6	620	9	663	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1CGA8	5.36e-72	1	620	4	663	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q95327	1.20e-71	4	644	23	722	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001572_00359.