CAZyme Information: MGYG000001572_00571

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R
• CAZyme ID: MGYG000001572_00571
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819	MGYG000001572_2|CGC2	89722.29	5.3593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001572	1887218	MAG	United States	North America

• Gene Location: Start: 116510; End: 118969 Strand: +

Full Sequence      

MKHPEIIKKMSLEQKAAFVSGFDYWHLEEAPALGLPKIMITDGPHGLRKQNKDKKASDGI
GLGNSVPATCFPPASTSSCSWDEDLIRQEGEALGEECLKEEVSTILGPGTNIKRSPVCGR
NFEYFSEDPYLAGKCSANLVNGVQSKGVGTSLKHFACNSQEAFRMVINEVIDERTMRELY
LTAFEICVKEAQPWTIMNSYNRINGVYASQNEWLQEKVLRDEWGFKGLIVTDWGASVDRI
PGLKNGTDLEMPSSGTLNTQKIIAAVKSGELDEAILDKRVDNVVDLIVKSKPALEKKHTY
DVEAHHKLAQKVAEGSMVLLKNDGGVLPLKKGQKIAVIGEMAKAPRFQGAGSSVINPTKL
DNAYDELSKLGVDMIYAQGYEKSKDEVNEAMFTEAEKAAEKADVAVVFAGLTEAFEGEGY
DRLNIEMPDCHNQLIARIVKANPNTVVVLAGGSVVHMPWVNDVKALLNSGLGGQAGGAAV
ANILTGAVNPSGKTSETYPLEFSDNPTYGNYPGGPVTSEHRESVYIGYRYYDKADKQVLF
PFGYGLSYTTFEYSDIKLSADSIKDTDTVKVSFKIKNTGSVDGAEVAQVYVADKESTIFR
PVKELRAFKKVFLKAGEEKEVSVELSKRAFAFYNVKLGDWMVETGEFDILVGASSRDIKL
TATMTVTSTVNAEIPDYRESAPAYYTADLNAMKGAQFEAVYGQKLPDPNPDTNKKIDLYC
CLNDARHTKWGGRICRLIENIMSKMGSDANGDGKMLAAMATQIPIRNFIAMSMGVMSEPM
AQGLLMILNDDESSFVGFNKLFWRIGGALTRLPALLKSI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	252	2.2e-61	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.77e-101	69	659	118	758	beta-glucosidase BglX.
COG1472	BglX	5.28e-64	29	339	54	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.54e-56	317	548	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.74e-51	30	623	76	740	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.47e-32	33	286	64	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53344.1	1.98e-275	1	789	1	786
AGS53563.1	3.51e-271	1	789	1	787
ANX02594.1	6.67e-263	5	675	7	677
ANW99954.1	2.69e-262	5	675	7	677
AGC67337.1	8.93e-262	5	675	42	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.38e-249	5	792	7	755	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.88e-213	7	666	9	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.77e-138	5	666	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.71e-137	5	666	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.28e-124	5	658	8	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.32e-249	5	792	7	755	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.61e-209	7	707	9	717	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	9.20e-207	7	707	9	717	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	3.99e-137	5	663	48	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	3.81e-132	6	658	14	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001572_00571.