CAZyme Information: MGYG000001574_00474

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000001574_00474
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000001574_4|CGC1	40331.23	5.5143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001574	1144892	MAG	United States	North America

• Gene Location: Start: 6600; End: 7676 Strand: +

Full Sequence      

MIKKILVTAVLATVMVPTMAAWHLWDEFRANAVENGRVIDRSDARKVTTSEGQSYAMFFA
LVANDRASFDGLVTWTADNLSAGDLTKTLPAWLWGQERGDKWGILDTNNATDSDMWIAWC
FLEAGRLWKDPEYTKKGLAMMELLKKEVRVVDNLGAVVLPGRVGFEDNGVVKLNPSYYPL
FIFKRFALEDPYWNDVYDGSLRMLLRSAPAGIAPDWALFDKNGRLVPPNGDDYEIGSYNA
IRTYLWAGMMSPDDPNRRRLLKHFEPMVEATKALNMPPEKIHTVNLKVNDTGPFGFGACL
MPMLENDRTAGLIRSVVVSEPLTGDSYYSSVLAMYGRGWDTGRFAFDRDGRLIFPKGW

Enzyme Prediction     

No EC number prediction in MGYG000001574_00474.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	22	339	1.8e-77	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	3.60e-155	5	353	8	365	cellulase.
COG3405	BcsZ	2.20e-83	22	346	26	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	2.22e-62	20	342	2	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53874.1	5.90e-173	3	353	2	359
QQS88762.1	1.28e-167	21	356	27	363
ANU67169.1	2.90e-122	3	356	2	352
QQQ96024.1	2.90e-122	3	356	2	352
QDA53782.1	8.29e-113	22	357	71	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	6.34e-102	22	353	4	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
4Q2B_A	2.73e-99	21	353	3	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
7F81_A	4.70e-98	22	352	8	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	1.33e-97	22	352	8	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	8.59e-97	22	353	4	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	2.02e-103	11	353	14	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8ZLB7	5.92e-103	21	353	25	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
P37651	3.26e-102	11	353	14	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8Z289	9.55e-102	21	353	25	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	1.26e-83	22	353	33	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.032641	0.965667	0.000793	0.000314	0.000261	0.000289

TMHMM  Annotations     

start	end
5	24