CAZyme Information: MGYG000001574_00929

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000001574_00929
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000001574_15|CGC1	39182.95	9.6296

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001574	1144892	MAG	United States	North America

• Gene Location: Start: 3851; End: 4849 Strand: -

Full Sequence      

MALRISLHKIRPSYILKPRGKNLKFVYYIRCALRNWVPQYWLKRHKTTLLNSLEHRTDKD
YILDRVNYYNKLTSITPVTGTKSLTDIPNKGSTYNRDTFEIARYFDPSLKIDTLFGDNVQ
IGTTPSIVKSRPIQADNQFDVVLNLDKVRHFTFLKDKRSFASKLNQAIFRGATYQSHRQR
FMNMYFGHPLVDCANTAHKSDLPSEWNKPLITLYDHLHYKFVICLEGNDVASNLKWVMSS
NSIAIMPKPKYETWFMEGRLQAGVHYIEIKDDFSDLEEKIQYYSQHIDEAEVIIRNAHEF
VHQFFDHTREELIAILVMQKYFEMTGQVHRSK

Enzyme Prediction     

No EC number prediction in MGYG000001574_00929.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	155	313	2.6e-20	0.708

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00672	CAP10	1.12e-12	211	309	138	237	Putative lipopolysaccharide-modifying enzyme.
pfam05686	Glyco_transf_90	3.91e-12	213	304	210	302	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
pfam13524	Glyco_trans_1_2	0.002	247	308	30	83	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS92068.1	8.70e-104	20	328	10	321
QSG83178.1	2.48e-103	20	328	10	321
AUX18339.1	5.70e-102	20	328	10	321
QQT24222.1	6.54e-101	19	327	10	319
QQT34018.1	5.60e-97	19	327	10	319

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39907	6.94e-71	24	324	11	314	O-glucosyltransferase LpsA OS=Dichelobacter nodosus OX=870 GN=lpsA PE=3 SV=1
Q6UW63	1.22e-07	162	300	300	442	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
Q9JHP7	2.89e-07	162	300	300	442	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1
Q7Z4H8	2.91e-07	159	323	303	470	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2
Q566E5	9.14e-07	159	323	304	471	Protein O-glucosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Poglut3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001574_00929.