CAZyme Information: MGYG000001576_01515

Basic Information

• Species: Dysosmobacter sp014297375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter; Dysosmobacter sp014297375
• CAZyme ID: MGYG000001576_01515
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		21190.89	6.226

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001576	3081635	MAG	United States	North America

• Gene Location: Start: 11298; End: 11867 Strand: -

Full Sequence      

MLLSPMRYKDYTWPHNPEVYTVERRRRLAVHPVPYGRCVVQDLGGSYRVLRGHGVFTGAG
AYEEFRRLAEVFQDSGSGMLVHPVWSTEQAWFASLTVEEEPLPDYVSYSFEFWEDWTGYG
NGLSAVKESADVPPLPARQPEGSSDTVHKGDTLWGIAKRHGVSLTALISANPQIKNPNLI
YPGDKVVIP

Enzyme Prediction     

No EC number prediction in MGYG000001576_01515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	146	189	7.6e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02899	spore_safA	6.82e-19	147	189	1	43	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]
cd00118	LysM	8.16e-15	146	188	4	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	2.83e-13	146	189	2	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	3.75e-13	146	188	3	44	Lysin motif.
PRK11198	PRK11198	5.16e-11	120	189	74	146	LysM domain/BON superfamily protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK83823.1	2.21e-144	1	189	1	189
QUO39535.1	6.25e-77	6	189	1	186
BAK99092.1	9.92e-75	1	186	1	188
QCI61061.1	1.75e-74	6	189	1	187
QNL45880.1	1.41e-67	6	188	1	180

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GFE2	1.03e-08	142	188	64	110	Chlorophenol reductase OS=Desulfitobacterium hafniense OX=49338 PE=1 SV=1
Q6B4J5	1.53e-07	147	189	6	48	Spore coat assembly protein ExsA OS=Bacillus cereus OX=1396 GN=exsA PE=2 SV=1
O32062	4.91e-06	147	189	6	48	SpoIVD-associated factor A OS=Bacillus subtilis (strain 168) OX=224308 GN=safA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001576_01515.