CAZyme Information: MGYG000001585_01348

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001585_01348
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000001585_72|CGC1	37800.79	4.918

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001585	2010564	MAG	Canada	North America

• Gene Location: Start: 4958; End: 6010 Strand: +

Full Sequence      

MKTGISIYLSSPLQDIERTIERGAAAGARYAFTSLHIPEDGGAAYADKVRHVLSLLSARG
IALIADVGPRTCDLLGLERIEDLRDLGLEYLRLDYGFSAQRVAELSGVFRIVVNASTVSS
DEIASWREAGADVTRFAACHNFYPKPYTGLALEDIARVNLRLAALGFEIMAFVPGDANVR
GPVFEGLPTVEAQRGRASKVALNMLELAHGADCDIVLVGDPDLSDAGWAQFAQVSAGYVD
LQCELEPGYAYVRGQIHHDRPDSSTLIFRSQESRTTLKPDSVPMDAGAGLSRKTGSIAVS
NSGYGRYEGELEIARVDLPGDERMNVAGHITPEAMELLPSIKRGFGVRFV

Enzyme Prediction     

No EC number prediction in MGYG000001585_01348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	3	349	1e-100	0.9914285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	7.76e-73	4	233	2	235	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	1.53e-66	1	350	2	357	Uncharacterized protein [Function unknown].
pfam05913	DUF871	1.46e-25	239	350	5	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG4070	COG4070	0.003	228	338	179	300	Uncharacterized protein, methanogenesis marker protein 3, UPF0288 family [Function unknown].
PRK00969	PRK00969	0.005	240	338	191	301	methanogenesis marker 3 protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53905.1	2.03e-250	1	350	1	350
QIA33651.1	7.93e-248	1	350	1	350
AZH69275.1	2.54e-244	1	350	1	350
QOY60728.1	2.63e-144	1	350	1	351
ADL06294.1	1.99e-116	1	350	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0O_A	6.75e-54	4	344	6	352	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]
1X7F_A	1.99e-22	2	338	28	372	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2XHV5	2.21e-32	3	342	2	336	6-phospho-N-acetylmuramidase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=mupG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001585_01348.