CAZyme Information: MGYG000001588_00265

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001588_00265
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39726.75	6.6659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001588	2411406	MAG	Canada	North America

• Gene Location: Start: 136; End: 1200 Strand: +

Full Sequence      

MEGRIRGVNLSGWFILEPWVTPSLFAATGASNDAELQQVLGPGAYNEHLRQHYETFVGED
DFRRMSVMGLNAVRIPVPWYAFGSQNERESYISCIDYLDRANEWAAKYGMRVLLDLATVP
GGQGDSNSSTTTPETTADWHSSASGRDAALDVLGRLAERYGTSDALLGLELLDSPMMSVR
RNLFSVTPGIPGHYLRNYYRDAYVRVRRHMPADRLVVFSASGHPDAWRHFMRGNQYENVV
MDLHLYHYRDEMAQDIATPHGLATAIARNKRLIREAKSAGFPVLVGEWSGAAVIAGSSVT
PEGRRAYERVFVSNQLATFDQAAGWFFQTWKTERRIAAWDARVALAPLERAMME

Enzyme Prediction     

No EC number prediction in MGYG000001588_00265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	327	5.6e-59	0.9834437086092715

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	4.67e-27	5	333	18	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	7.65e-06	59	290	27	238	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68982.1	1.77e-193	4	354	3	353
QIA34389.1	1.77e-193	4	354	3	353
ATP54675.1	2.51e-193	4	354	3	353
AEB06471.1	6.74e-175	1	353	1	353
QWT17456.1	4.99e-171	3	354	27	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.56e-42	4	331	2	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	4.25e-42	4	331	2	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	4.85e-33	5	333	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	1.40e-32	5	333	14	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.79e-32	5	333	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RAR6	3.49e-44	5	346	42	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
B8N151	4.04e-43	4	333	30	376	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	4.04e-43	4	333	30	376	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q5B5X8	4.30e-41	4	346	28	386	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q4WK60	1.44e-40	2	346	39	398	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998569	0.001365	0.000064	0.000006	0.000003	0.000016

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001588_00265.