CAZyme Information: MGYG000001588_01566

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001588_01566
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		65788.68	4.9807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001588	2411406	MAG	Canada	North America

• Gene Location: Start: 2792; End: 4636 Strand: +

Full Sequence      

MTKRCGASSSGTGSQVMSRRSALCAGAAASLALLAPHGAHADEVGGLAGVHADHPAQSWR
YEDGLPISPAETESGRSFRSVFEKWGSNGDGGWINSVGDLIPGAIMRGIDVSEWQGNIDW
MSVKADDVSFAIIRAAKWAGLDSKGRRGIDDRWEQNARGCEQNGIPFGAYIYSYARNVAD
AREEADCLIDLVRGHKVSYPLYIDLEDSYIAGADLNAIAAAFCERIEAAGHRAGVYANLG
WWNTKLTDPVLGSWSRWVAQYNVTCDYTGQKDLWQATSKGSISGISGKVDLNFAYVDLDA
SYDGQAIWSRVYGQDQLDTMQKISQSGWQSSESVVIATDASFWDALTASSLAGTYGCPIL
LTKRDSLSWQARDEVVRLGARKAFVCGGPIAIASDIDDELRRAGCQDVVRIYGADQQGTA
REIANHVRASGGSDTCIIATDWKFQDALSISPFAFAKRAPIYLCETGSKALSADTLLSIG
GFGFKKAIIVGGPVAVSPDVERQLASVGVAQVSRIYGQTEYETSKAIAAWELQQGMTVDQ
AAVATGVTFYDALAGAALCGKNNSVLTIVSDYNRVCITDFIAQHKGEVSSGYVFGGPIAV
SDATWKMLLRSYFA

Enzyme Prediction     

No EC number prediction in MGYG000001588_01566.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	109	285	5.6e-42	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	4.58e-83	106	295	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.26e-39	107	292	1	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06524	GH25_YegX-like	4.44e-25	107	292	1	190	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06523	GH25_PlyB-like	1.12e-24	109	292	3	175	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	1.44e-24	109	285	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY61389.1	6.42e-202	23	532	28	535
AWY97591.1	4.56e-62	58	299	49	289
QCP36076.1	3.49e-60	55	293	43	285
QCT06313.1	2.43e-58	55	341	36	343
QMW70652.1	6.76e-57	55	293	43	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JZ5_A	1.40e-20	109	298	26	216	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]
4KRU_A	4.20e-15	106	292	20	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WW5_A	4.40e-15	109	295	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.03e-14	109	295	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRT_A	2.15e-14	106	292	20	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	1.75e-20	310	608	30	313	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
P25310	1.73e-11	106	292	82	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	1.14e-09	106	292	9	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	2.40e-07	106	292	1	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000004	0.000060	0.000003	0.993335	0.006594	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001588_01566.