CAZyme Information: MGYG000001589_00648

Basic Information

• Species: Pyramidobacter piscolens
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Dethiosulfovibrionaceae; Pyramidobacter; Pyramidobacter piscolens
• CAZyme ID: MGYG000001589_00648
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000001589_5|CGC1	41226.26	8.6611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001589	2462654	MAG	China	Asia

• Gene Location: Start: 63276; End: 64382 Strand: -

Full Sequence      

MSIFISTGELSGDIYAAKLSAALHKILPHEQLWGMGGALAEGICKEWDNALLHIIGLGRI
IKSLPSLFQLRKELAEAVVKRAPRAVIVVDSPDFHIPLLSKIRALGYKGPVVYVCPPTIW
AWRSGRAKYLKRYCDLCLPLFHFEEKALQAWNVRSYWCGNPLIDDLDKFIPVGASLPDDA
MRVALLPGSRRSEIKTLLPVLQETALKLKETGLHPVFSIAPGLDEASKTMVRNNKAGIEA
TEISGRNLMHASKFVIGASGTTAVEAMLLNRYMIVLYKGTALEWRIYKMLTHTPFVSIPN
VLAEKMMFPELLQDDSRADRILHYVDLYLHDKNYCDDIHKQIVSNRRLMGEPGAIQRWAE
AISELVNS

Enzyme Prediction     

No EC number prediction in MGYG000001589_00648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	341	2.6e-83	0.9689265536723164

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	5.58e-85	1	367	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.27e-80	1	368	2	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	4.92e-69	3	347	1	367	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	2.53e-41	2	351	228	598	lipid-A-disaccharide synthase; Reviewed
PRK14089	PRK14089	2.78e-36	54	323	50	311	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AER66289.1	4.94e-112	1	362	1	366
ADE57615.1	4.98e-97	1	362	1	359
AFM20975.1	7.99e-91	1	366	1	365
ANZ45970.1	1.96e-88	1	364	1	372
QVL35430.1	9.67e-85	1	365	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.64e-36	1	321	7	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.47e-35	1	321	7	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.42e-61	3	366	7	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	1.92e-54	3	362	11	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	7.48e-54	3	362	11	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.05e-53	3	362	11	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q1R020	4.39e-53	1	366	1	375	Lipid-A-disaccharide synthase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999672	0.000355	0.000007	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001589_00648.