CAZyme Information: MGYG000001590_00197

Basic Information

• Species: Desulfovibrio sp900547595
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio sp900547595
• CAZyme ID: MGYG000001590_00197
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661		75497.07	7.5615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001590	2294085	MAG	China	Asia

• Gene Location: Start: 44356; End: 46341 Strand: +

Full Sequence      

MSAIFFHLHTWGTGADCLQRFAFRRREWLAEQNLVYSHTAFETLAYAQNHQALCNHLIHG
RPANGVYPAHVQKVFASWKEALDSGKNILISYRPKELTKSFLVLHSTFSTLPGFGDFKKK
YFISLGRLDFALEEFLRAWPYPRDASVLETMRDLDSYAAVLKRALRIAGPENLLVTMPQI
QPGVSGCHEPATQAAQLMAFAGVSESTAAEAAHGICAEIEPWRSARIKRLFSSINNAWGK
PSVEELASELQAFESSPGTGQIFCSREVANEITAFHRQDWEKAMGMAGVRQEWKPFVFLE
KPDAVAPFRHLGVLAPKTTAYIRDNIFLLPEDWRGAAENIMAQSGTRISPPPDMAVLTMT
YNHEKYLEECIESVAAQKHSFSLEHVIVDDCSNDGTRELIAAKAKKYSHLRPVLLESREG
HANIRALFRSCRSKYAALCDGDDYFTDSAKLQKQYEYLEKNPDCSICAHPVHVHFENEKM
KDFSYPELKQLPCAKDGKYSIEDIISRNFVQTNSVVYRWRFEQGLPKWFRADICPSDWYW
HLLHAEKGRIGFLPDIMAVYRRHDKAHYAHAFISTVKHRQERGMEELETYKAVNEHFQGK
YFDKLAQLANGVLANFLELALRENGNRLLDIAEKKYPEFCRYFLKSLELIQCNSMGNSVA
R

Enzyme Prediction     

No EC number prediction in MGYG000001590_00197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	356	480	1.5e-23	0.7352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	4.09e-22	360	473	6	118	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04196	GT_2_like_d	1.40e-21	355	564	1	206	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	3.54e-21	356	470	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	4.27e-17	352	636	3	266	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04179	DPM_DPG-synthase_like	2.49e-14	360	442	5	89	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD91126.1	4.39e-108	300	659	307	670
QTO41456.1	4.20e-89	291	653	301	672
QEE39070.1	4.87e-52	352	649	108	399
AYO81797.1	2.69e-50	352	649	108	399
BBX74730.1	1.00e-49	352	563	10	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	3.45e-07	352	460	5	111	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P64864	1.65e-47	354	599	1	239	Uncharacterized protein Mb1547 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1547 PE=4 SV=1
P9WLV4	1.65e-47	354	599	1	239	Uncharacterized protein MT1570 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1570 PE=4 SV=1
P9WLV5	1.65e-47	354	599	1	239	Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
O32268	1.23e-10	352	458	6	111	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
P71059	6.70e-06	352	461	3	110	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.989894	0.010043	0.000048	0.000026	0.000014	0.000027

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001590_00197.