CAZyme Information: MGYG000001591_00654

Basic Information

• Species: Parabacteroides timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides timonensis
• CAZyme ID: MGYG000001591_00654
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000001591_7|CGC1	33232.95	6.9082

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001591	5999279	MAG	China	Asia

• Gene Location: Start: 12736; End: 13599 Strand: +

Full Sequence      

MKNKLLISLVLCILFNLNGMGQSAVFESLKFDSKKLGKEVSYSIYLPSDYNTSQRKYPVL
YLLHGYTDDETMWIQTGDVKEIVDKAIDSGDATQMIVVMPNAWDTWYINQYDGKAPYEDM
FFEELIPYIEKTYRARSRQEFRAIAGLSMGGYGSFLYSLHHPDMFSACAPLSAAIFDDSV
MEKRQAQSHKDLFSRLFGPGLNYWHKNSVLKILSELDKENLPRIRYYIDCGDRDGLLEGN
YQAHKIMQEKGMKHEFRVRGGGHTWLYWRTALPEVLEFVSGAFRRNQ

Enzyme Prediction     

No EC number prediction in MGYG000001591_00654.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	279	1.3e-59	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	3.16e-35	30	286	72	299	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.14e-33	33	276	1	243	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	6.04e-33	39	285	34	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	3.92e-11	26	285	9	264	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG4099	COG4099	2.17e-09	26	172	160	301	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59664.1	2.57e-34	31	284	151	393
QBJ18653.1	2.80e-34	31	274	156	391
AMQ56447.1	3.11e-34	31	272	148	377
QUT61354.1	3.90e-34	31	274	156	391
QUT65956.1	3.90e-34	31	274	156	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.65e-51	22	286	9	275	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	4.97e-24	31	274	137	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	3.37e-23	44	279	157	384	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
4RGY_A	8.81e-22	31	279	9	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
1JJF_A	1.61e-21	44	282	50	260	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.11e-23	44	285	449	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	1.05e-19	44	282	69	279	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	9.02e-18	27	277	501	722	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P23553	3.59e-16	29	280	6	262	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P9WM38	1.63e-14	30	264	178	426	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000708	0.997329	0.001342	0.000203	0.000201	0.000197

TMHMM  Annotations     

start	end
5	26