CAZyme Information: MGYG000001591_00667

Basic Information

• Species: Parabacteroides timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides timonensis
• CAZyme ID: MGYG000001591_00667
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001591_7|CGC2	42729.98	7.0209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001591	5999279	MAG	China	Asia

• Gene Location: Start: 30266; End: 31390 Strand: +

Full Sequence      

MISKRIPFKHIAAVIMLGCAAVSLQAADLKKDEVTTIARKVADWQIKEFPTNKYAVSEPK
GWIAGALYMGMFDWAELSGDEQYFDWMKKVFNRQHWQVADRMYHADDVCVSQTYIDMYGK
YKEDKMLLPTLARIDWVVNNPSKGGMDIDYSKPLSYERWSWCDALFMAPAVYTRLYTLTG
NRKYMIFADTEFKATYNHLYDKEEKLFFRDSRYFNQKEANGQKVFWGRGNGWVIGGLAEI
LKTLPADDSEYRPFYLQLFKEISERLAGLQNKDGFWHASLLDPASYPSPETSATGFIVYG
LAYGVNQGYLPADKYLPVIEKGWAALCSAVESDGKLGWVQPVGADPRKVTKEMTELYGTG
AFLMAACEIHRLAK

Enzyme Prediction     

No EC number prediction in MGYG000001591_00667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	371	6.3e-90	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.40e-99	37	372	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.87e-51	61	373	35	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48952.1	2.56e-217	20	373	86	439
QIU93494.1	7.59e-160	9	374	4	372
ASM65072.1	2.51e-158	15	374	12	372
QUU06865.1	2.51e-158	15	374	12	372
QRP56352.1	2.51e-158	15	374	12	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.27e-75	31	372	26	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	5.16e-56	62	368	56	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.18e-50	62	368	39	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.59e-84	37	369	60	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	2.71e-76	4	374	2	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	8.51e-75	31	372	33	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	7.76e-12	62	339	31	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000503	0.694192	0.304485	0.000270	0.000273	0.000234

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001591_00667.