CAZyme Information: MGYG000001591_00714

Basic Information

• Species: Parabacteroides timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides timonensis
• CAZyme ID: MGYG000001591_00714
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		89217.42	6.2819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001591	5999279	MAG	China	Asia

• Gene Location: Start: 106901; End: 109246 Strand: -

Full Sequence      

MKNKLILTFLLATGIIGGSLACEHCTNLVQVKDVVPAKVNYFSLKDVRLLDSPFKHAMEL
NNEWMMELDMDRLLSNFRKNADLEPKAESYGSWEAMGIAGHTLGHYLTALSQQYASTGDE
ECKRRVDYIVSELDSCQINFVNGFIGGMPGGDKVFKEVKKGIIRSKGFDLNGIWVPWYNE
HKTMMGLSDAYLLVGNETAKKVLVNLSDYLADIISGLSNEQIQEMLNCEYGGMNEAFAQV
YALTGDKKYLDASYKFYHERLQDKLAEGLDVLPGLHSNTQIPKIIGSARQYELTGNKRDE
KIAEFFWHTIVHSHSYANGGNSMGEYLSTPRKLNDRLATTTCETCNTYNMLKLSQHLYRW
TDDPQYLDYYERALYNHILASQHPEDARTCYFVSLGMGTRKNFYSKDNNFTCCMGSGFEN
HSKYGGAIYSYTTDKNDLNVNLYIPSVLTWKERNIRLKMETAYPEDGKVAIRLEECPSQQ
FDINLRYPAWAISGVTLKVNGSKQSVSVQPGSFITISRKWKKGDRIEVNFPMSLYTESMP
DNADRRAVFYGPSLLAGVFGPQERKIGDVPVFINEEKDMVKQIEPVKGQPLTFHTVAPGG
PDNVAMIPFFKTYDQYYTVYWDVFSPEEWKQVEAKRTAELERIARLDAKTLDYITLGEMQ
PERDHNLEGENTRVGEFGIHKYRFAYEEGWFSFNMKCGYNGPTQFLMTYWGGDSGKYTFE
LVIDDTWVQPITVKGNPEEFVEMVIDLPKELTEGKDKIKVMFRGVGKNRVSNLYNCRLMK
K

Enzyme Prediction     

No EC number prediction in MGYG000001591_00714.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	46	556	3.5e-203	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	46	556	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.27e-130	44	633	9	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.66e-11	560	621	21	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
cd04434	LanC_like	4.47e-05	97	252	3	182	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67732.1	0.0	31	781	28	777
ADY34343.1	0.0	1	780	3	782
SNV45513.1	0.0	3	780	2	779
QEM13389.1	6.00e-254	31	780	29	778
AYL99343.1	1.77e-244	29	780	35	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.28e-176	38	780	24	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.54e-170	38	780	24	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	2.13e-19	236	532	198	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	9.80e-14	56	566	37	581	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.55e-12	175	566	185	581	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001500	0.347259	0.650683	0.000177	0.000192	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001591_00714.