CAZyme Information: MGYG000001591_00802

Basic Information

• Species: Parabacteroides timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides timonensis
• CAZyme ID: MGYG000001591_00802
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		68611.3	6.4428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001591	5999279	MAG	China	Asia

• Gene Location: Start: 98094; End: 99908 Strand: -

Full Sequence      

MSAWAQVPTQSSVTHVRISGYVGERIDDCIEHRVKTQDVDHLVEPFRHREEKSRWQSEFW
GKWIQGAIASYRYNQDPELYQIIKDAAESLMKTQTMDGYIGNYAPDAQLQQWDIWGRKYT
TLGLIAWYDLSGDKKALNAACRVVDHLMTQVGPGKVNIVSTGNYIGMPSSSILEPVMYLY
NRTKETHYLDYAKYIVEQWETPEGPQLISKAIVDIPVASRFPHPKAWFSRENGQKAYEMM
SCYEGLLELYKVTGNPLYLSVVEKTVGHIVREEINIAGSGSAFECWYSGKVRQTIPTYHT
METCVTFTWMQLCNRLLQMTGNSLYADYMESAIYNALMASLKADASQIAKYSPLEGCRHE
GEEQCGMHINCCNANGPRAFAMIPQFAYQVKDDCIRVNFYGESEAEIMLPGKKNVKLRQV
TDYPVADEIILQVELAKESSFTIALRIPAWSRLATVQVNGESVEDVLQGAYLPITRKWKA
GDKITVRLDLRARLVEMNQAQAIVRGPLVLARDSRFNDGFIDETTVVVSKDGYVELTPVK
APDFAWMTFTAPLILGTDLEGNSVARPIHFCDFASAGNTWDKSQRYRVWLPRTLNVMHAP
YKPY

Enzyme Prediction     

No EC number prediction in MGYG000001591_00802.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	50	510	8.4e-65	0.9083969465648855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	6.21e-73	13	526	14	515	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	2.51e-65	61	511	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	4.45e-237	9	604	20	620
ACM22580.1	4.60e-47	62	561	83	584
AJG40529.1	6.90e-45	62	561	81	582
AXC10260.1	2.92e-42	62	512	133	592
SNY90695.1	4.68e-42	12	563	23	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	6.43e-35	62	517	74	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.07e-30	28	509	40	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.50e-28	28	509	40	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	6.79e-24	19	514	48	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6YQH_AAA	3.94e-21	302	511	337	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.95e-17	62	519	80	574	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999944	0.000081	0.000007	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001591_00802.