CAZyme Information: MGYG000001591_01019

Basic Information

• Species: Parabacteroides timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides timonensis
• CAZyme ID: MGYG000001591_01019
• CAZy Family: GH20
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523	MGYG000001591_11|CGC3	60135.14	6.8212

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001591	5999279	MAG	China	Asia

• Gene Location: Start: 70446; End: 72017 Strand: -

Full Sequence      

MKRLGYISILLFVFIVLTWAQSVLLPAPVKFNQGNGTWVVNADVKIIANCEQAKKIGEGL
RRQLKETTFSQTEKAGVVSFRQVREVEIPSEGYELNITKDTAEVKASSEAGLFYGKEALL
QLIRAGKGHVNVCRIQDNPRFAWRGFMLDESRHFFGKEKVMQYLDIMASLRLNVFHWHLT
DEPGWRIEIKRYPKLTTIGAVGNWHDSKAAPMFYTQEEIKEVVAYAAERHIMVIPEFDMP
GHATSACRAYPELSGGGEGRWDGFTFHPCKEETFEFISNVLDEIVELFPAPYIHIGGDEV
HYGNQNWFKDPEIQRFIQEKKLVNETGLEHYFIRRATDLVASKGKIMVGWDEIVDAGVSP
EKAVVMWWRHDRKYQLVKALERGYKVVMTPRLPLYGDFVQYPTHTVGRYEQCNLLEDVYC
FPEPIMNLAEGYEEQIMGIQYSAWSERIDKGKRLDFMTFPRLFAVAESAWTPVIKKNTGM
FLKKLPIYLSWLDKLGIYYFNPFNPSSAPEPPAPDKQDVLKNG

Enzyme Prediction     

No EC number prediction in MGYG000001591_01019.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	136	472	3.6e-106	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	6.63e-161	141	485	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	3.73e-141	141	472	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	3.20e-98	90	504	205	647	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	9.63e-93	141	485	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	4.60e-91	141	472	1	298	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50216.1	4.54e-270	1	523	1	524
ANQ62643.1	1.03e-239	86	523	73	511
CAH06100.1	1.03e-239	86	523	73	511
QCT76948.1	1.03e-239	86	523	73	511
QCQ40074.1	1.03e-239	86	523	73	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CBN_A	1.50e-94	91	508	78	519	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
7DUP_A	7.63e-81	21	485	3	506	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
3RCN_A	2.64e-80	24	511	10	521	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7DVB_A	4.15e-80	21	485	3	506	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
6Q63_A	1.32e-78	21	499	30	536	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UQG6	1.10e-93	91	508	97	538	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P49008	3.36e-84	24	502	37	535	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
P96155	8.27e-68	24	468	141	603	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
Q04786	1.53e-51	24	470	200	717	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
B2UP57	5.03e-51	56	494	28	471	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.265205	0.732082	0.001535	0.000363	0.000311	0.000464

TMHMM  Annotations     

start	end
7	29