CAZyme Information: MGYG000001591_03105

Basic Information

• Species: Parabacteroides timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides timonensis
• CAZyme ID: MGYG000001591_03105
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000001591_51|CGC2	71777.8	4.7475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001591	5999279	MAG	China	Asia

• Gene Location: Start: 29815; End: 31731 Strand: +

Full Sequence      

MKHKLLISALLIAVIGWVGCSVQQPVPSGTAYNYSNILDIRYTPDSASRCRGWFTDAGAW
YGFTLPRQEQWVNGFCGPFHLDMNKRQWLSDALVKVRFDGEDPDVVYTPDSVSYFPGELY
MSSSSETGRIEQRLVFVDKSTALLTCSSDQNTLLRFAGEVLPDDVACTTDKNRVLLTWPS
GEGVALTFSPEMGILSSEKGYETLTLTPGKSNVVISFFENEASRQAVLHRAAVVQASPVE
YREETASRWEGYLQKVLRSDMPEAYNRIAVKAVVTLIANWRSARGDLFHDGVVPSHAVGY
FVGFWGWDSWKHAVALARFAPDLAKDQVRTMFDYQTPEGMIIDCIYSDASENNARDSKPP
LAVWAVDEIYKATGDTAFVKEMYPKLLHYYKWWFTHRDHNNNGICEFGACDGTLEAAAWE
SGMDNAIRFDDAVMVKNSDGAWSMDQESVDLNAFLALEHRLLGELAPIAGEVFEDPDRSA
EIRDYFFVSDPGFFFDKRLDGTSVMEEGTEACIPLWAEIASREQAAAAMKIFSDTTKFAT
YIPFPTIAADNPKFMPAGYWRGPIWLDQVYFGISGIRKYGYKKEADAFTDQVFTRLQGLK
EDAPIHENYDTHNGAHLKAPHFSWSSAHLLMLYEEYGK

Enzyme Prediction     

No EC number prediction in MGYG000001591_03105.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	214	636	5.5e-108	0.5263157894736842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	4.28e-134	1	636	1	783	alpha-glucosidase; Provisional
COG3408	GDB1	3.47e-16	305	633	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.49e-08	292	637	119	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	1.40e-04	352	637	193	545	alpha,alpha-trehalase
pfam03200	Glyco_hydro_63	0.002	376	634	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT86878.1	1.67e-284	1	638	1	644
QJR62245.1	2.37e-284	1	638	1	644
QJR61716.1	2.37e-284	1	638	1	644
AII67042.1	2.37e-284	1	638	1	644
AII61903.1	2.37e-284	1	638	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.20e-79	31	636	2	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.70e-78	31	636	2	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.75e-78	31	636	2	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	5.25e-75	31	636	3	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	1.79e-41	16	409	313	768	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.24e-78	1	636	1	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	8.66e-14	297	627	90	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.02e-13	297	627	90	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000024	0.005567	0.994431	0.000003	0.000005	0.000003

TMHMM  Annotations     

start	end
5	27