CAZyme Information: MGYG000001593_00753

Basic Information

• Species: Christensenella hongkongensis
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae; Christensenella; Christensenella hongkongensis
• CAZyme ID: MGYG000001593_00753
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198	MGYG000001593_22|CGC1	22389.39	4.5765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001593	2717636	MAG	China	Asia

• Gene Location: Start: 10006; End: 10602 Strand: -

Full Sequence      

MGRTTSRRNSGKKKVIIISVCVIIVAVVGIVGFTQLSESWEKSKYPLEYQDLIEKYAAQY
DLDPYFIAAVINTESGFDASAVSSAGAQGLMQIMPETAEWIAGKLGDKELDPKNLTDPET
NIEMGCWYLQFLKERFDNNLPVMMAAYNAGHNKVRSWLDDPQYSDGENLTNIPYPETENY
VKKVTKAYEEYQKLYQLG

Enzyme Prediction     

No EC number prediction in MGYG000001593_00753.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	193	4.6e-34	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.38e-83	46	189	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.88e-63	45	194	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.12e-43	64	189	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.66e-41	37	195	127	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	9.35e-35	53	158	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	7.09e-88	1	198	1	197
QWT54455.1	3.12e-58	7	198	21	209
ACL76418.1	1.04e-55	7	195	6	191
APH13298.1	2.20e-54	22	195	9	179
AUM96786.1	3.12e-54	22	195	9	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.26e-25	44	184	411	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.29e-25	44	184	415	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.34e-25	44	184	421	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.37e-25	44	184	425	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.41e-25	44	184	431	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.25e-24	53	188	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC4	6.57e-22	42	195	473	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	6.57e-22	42	195	473	628	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	8.94e-22	42	191	473	624	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	5.77e-20	45	190	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.958979	0.037187	0.000539	0.000248	0.000164	0.002909

TMHMM  Annotations     

start	end
15	37