CAZyme Information: MGYG000001593_01115

Basic Information

• Species: Christensenella hongkongensis
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae; Christensenella; Christensenella hongkongensis
• CAZyme ID: MGYG000001593_01115
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000001593_39|CGC1	37765.59	8.4191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001593	2717636	MAG	China	Asia

• Gene Location: Start: 12949; End: 14010 Strand: +

Full Sequence      

MSKKIVLTGGGSAGHVTPNLALVPGLLEHGIEVHYIGTADGIEHTLVHDIPYHAISAGKL
RRYASAKNVSDVFKIFKGYGEAKKVLREIKPDLVFAKGGFVSVPVAWAAAKLQIPVILHE
SDYTPGLANRLCTKKAQKICLSFDTPQAHDGKGILTGSPVRADLLTGDKKAGLAKLGFSG
ELPVLLIMGGSLGAQAVNDAVDAVADELLQKYSIVHLRGKGKLNPALNGKANYRQFEYID
SGLNDIFAAADLALSRSGANAVFEFLALKLPALLVPLPLSASRGDQILNANYFVKRGYAR
VLEQENLNADTLPEALNDLMANREVLISNMEQSTEANGLENVQRIILESIGVK

Enzyme Prediction     

No EC number prediction in MGYG000001593_01115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	185	335	3.7e-40	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	1.20e-118	2	348	1	351	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	1.87e-118	2	351	1	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	3.45e-97	3	346	1	348	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	1.04e-96	4	348	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam03033	Glyco_transf_28	1.23e-42	5	139	1	137	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH40137.1	3.04e-210	1	353	1	353
ACR71089.1	3.72e-126	3	349	2	352
BCN32922.1	4.93e-124	3	348	2	351
QDW72608.1	1.99e-123	3	346	2	349
ASN93466.1	5.67e-123	3	346	2	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	1.20e-42	3	348	7	349	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	1.86e-40	1	333	1	335	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.08e-34	3	346	10	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z1B5	7.44e-127	3	349	2	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=murG PE=3 SV=1
A9KK83	1.78e-120	3	348	2	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=murG PE=3 SV=1
Q8XIQ1	1.90e-115	4	349	5	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=murG PE=3 SV=1
Q0SRB4	1.90e-115	4	349	5	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=murG PE=3 SV=1
Q0TNP7	1.90e-115	4	349	5	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=murG PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001593_01115.